SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000013836 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013836
Domain Number 1 Region: 321-510
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.97e-50
Family Hemopexin-like domain 0.00041
Further Details:      
 
Domain Number 2 Region: 122-286
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.34e-44
Family Matrix metalloproteases, catalytic domain 0.0000571
Further Details:      
 
Domain Number 3 Region: 29-95
Classification Level Classification E-value
Superfamily PGBD-like 5.34e-16
Family MMP N-terminal domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04

Protein sequence

External link(s) Protein: ENSRNOP00000013836   Gene: ENSRNOG00000047940   Transcript: ENSRNOT00000013836
Sequence length 525
Comment pep:known chromosome:Rnor_5.0:10:70293730:70314711:-1 gene:ENSRNOG00000047940 transcript:ENSRNOT00000013836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTGLSLLLRVLPLLLWGCQDAQPTPRGHPELHQEAEAFLEKYGYLSEQGSKVPASTQFS
DAIREFQWVSQLPISGVLDRATLRQMTRPRCGVADTDSHETWTERIRALLAGHRAKMRRK
KRFAKPGHKWYKQHLSYRLVNWPKSLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPAD
IRLTFFQGDHNDGLANAFDGPGGALAHAFLPRRGEAHFDQDERWSLSRRRGRNLFVVLAH
EIGHTLGLTHSPAPRALMAPYYKKLGRDALLSWDDVLAVQNLYGKPLGRSVATQLPGKIF
TDFEAWDPHNSQSRRPETRGPKYCHSSFDAITVDGQWRLYVFKGSHFWEVTADGNVSEPH
PLQKRWPGLPSSIEAAAVSLEDGDFFFFKGNRCWRFQGTKSVFAQLCRAGGLPRHPDAAL
FFPPLRRLVLFKGSRYYVLARGGMQVEPYYPRSLRDWAGVPEEVSGALPRPDGSIIFFRD
DHYWHLDQAKLRVTSSGRWATELSWMGCWNANSGGALFQRLPVTE
Download sequence
Identical sequences A1EC81
10116.ENSRNOP00000013836 ENSRNOP00000013836 ENSRNOP00000013836 ENSRNOP00000060554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]