SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSRNOP00000013836 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013836
Domain Number 1 Region: 321-510
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.97e-50
Family Hemopexin-like domain 0.00041
Further Details:      
 
Domain Number 2 Region: 122-286
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.34e-44
Family Matrix metalloproteases, catalytic domain 5.71e-05
Further Details:      
 
Domain Number 3 Region: 29-95
Classification Level Classification E-value
Superfamily PGBD-like 5.34e-16
Family MMP N-terminal domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
metallopeptidase activity 1.956 173.69
endopeptidase activity 1.539 149.07
zinc ion binding 1.658 43.61
integrin binding 1.752 17.74
cytokine receptor binding 2.034 15.08
growth factor receptor binding 1.996 15.08
enzyme activator activity 1.402 14.46
amide binding 1.71 13.19
collagen binding 1.837 10.43
protein complex binding 1.49 8.1
Cellular Component IC (bits) H-Score
brush border 1.481 22.53
Golgi lumen 2.24 12.28
secretory granule 1.827 10.56
neuron projection terminus 2.132 9.5
lysosomal membrane 2.005 8.2
trans-Golgi network 1.798 8.02
coated vesicle 1.745 7.82
clathrin-coated vesicle 1.877 7.82
dendrite 1.548 7.12
synapse part 1.513 5.74

Protein sequence

External link(s) Protein: ENSRNOP00000013836   Gene: ENSRNOG00000047940   Transcript: ENSRNOT00000013836
Sequence length 525
Comment pep:known chromosome:Rnor_5.0:10:70293730:70314711:-1 gene:ENSRNOG00000047940 transcript:ENSRNOT00000013836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTGLSLLLRVLPLLLWGCQDAQPTPRGHPELHQEAEAFLEKYGYLSEQGSKVPASTQFS
DAIREFQWVSQLPISGVLDRATLRQMTRPRCGVADTDSHETWTERIRALLAGHRAKMRRK
KRFAKPGHKWYKQHLSYRLVNWPKSLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPAD
IRLTFFQGDHNDGLANAFDGPGGALAHAFLPRRGEAHFDQDERWSLSRRRGRNLFVVLAH
EIGHTLGLTHSPAPRALMAPYYKKLGRDALLSWDDVLAVQNLYGKPLGRSVATQLPGKIF
TDFEAWDPHNSQSRRPETRGPKYCHSSFDAITVDGQWRLYVFKGSHFWEVTADGNVSEPH
PLQKRWPGLPSSIEAAAVSLEDGDFFFFKGNRCWRFQGTKSVFAQLCRAGGLPRHPDAAL
FFPPLRRLVLFKGSRYYVLARGGMQVEPYYPRSLRDWAGVPEEVSGALPRPDGSIIFFRD
DHYWHLDQAKLRVTSSGRWATELSWMGCWNANSGGALFQRLPVTE
Download sequence
Identical sequences A1EC81
ENSRNOP00000013836 10116.ENSRNOP00000013836 ENSRNOP00000013836 ENSRNOP00000060554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]