SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSRNOP00000013836 from Rattus norvegicus 73_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000013836
Domain Number 1 Region: 321-510
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.97e-50
Family Hemopexin-like domain 0.00041
Further Details:      
 
Domain Number 2 Region: 122-286
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.34e-44
Family Matrix metalloproteases, catalytic domain 5.71e-05
Further Details:      
 
Domain Number 3 Region: 29-95
Classification Level Classification E-value
Superfamily PGBD-like 5.34e-16
Family MMP N-terminal domain 0.0056
Further Details:      
 

Protein sequence

External link(s) Protein: ENSRNOP00000013836   Gene: ENSRNOG00000047940   Transcript: ENSRNOT00000013836
Sequence length 525
Comment pep:known chromosome:Rnor_5.0:10:70293730:70314711:-1 gene:ENSRNOG00000047940 transcript:ENSRNOT00000013836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTGLSLLLRVLPLLLWGCQDAQPTPRGHPELHQEAEAFLEKYGYLSEQGSKVPASTQFS
DAIREFQWVSQLPISGVLDRATLRQMTRPRCGVADTDSHETWTERIRALLAGHRAKMRRK
KRFAKPGHKWYKQHLSYRLVNWPKSLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPAD
IRLTFFQGDHNDGLANAFDGPGGALAHAFLPRRGEAHFDQDERWSLSRRRGRNLFVVLAH
EIGHTLGLTHSPAPRALMAPYYKKLGRDALLSWDDVLAVQNLYGKPLGRSVATQLPGKIF
TDFEAWDPHNSQSRRPETRGPKYCHSSFDAITVDGQWRLYVFKGSHFWEVTADGNVSEPH
PLQKRWPGLPSSIEAAAVSLEDGDFFFFKGNRCWRFQGTKSVFAQLCRAGGLPRHPDAAL
FFPPLRRLVLFKGSRYYVLARGGMQVEPYYPRSLRDWAGVPEEVSGALPRPDGSIIFFRD
DHYWHLDQAKLRVTSSGRWATELSWMGCWNANSGGALFQRLPVTE
Download sequence
Identical sequences A1EC81
ENSRNOP00000013836 10116.ENSRNOP00000013836 ENSRNOP00000013836 ENSRNOP00000060554

Jump to [ Top of page · Domain architecture · Domain assignment details ]