SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSRNOP00000015913 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015913
Domain Number 1 Region: 5-293
Classification Level Classification E-value
Superfamily Mitochondrial carrier 7.85e-88
Family Mitochondrial carrier 9.22e-11
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
organelle inner membrane 1.673 62.04
mitochondrial envelope 1.571 58.85
microtubule cytoskeleton 1.334 20.08
plastid 1.598 10.19
chloroplast part 1.897 10.19
mitochondrial inner membrane 1.752 5.48
microbody 1.956 4.87
intrinsic to organelle membrane 2.091 4.87
outer membrane 2.24 4.86
mitochondrial membrane part 1.917 4.04

Protein sequence

External link(s) Protein: ENSRNOP00000015913   Gene: ENSRNOG00000039980   Transcript: ENSRNOT00000015085
Sequence length 298
Comment pep:known chromosome:Rnor_5.0:X:123549683:123552808:1 gene:ENSRNOG00000039980 transcript:ENSRNOT00000015085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT
Download sequence
Identical sequences Q09073
ENSRNOP00000015913 10116.ENSRNOP00000015913 ENSRNOP00000015913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]