SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSRNOP00000015913 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015913
Domain Number 1 Region: 5-293
Classification Level Classification E-value
Superfamily Mitochondrial carrier 7.85e-88
Family Mitochondrial carrier 9.22e-11
Further Details:      
 

Protein sequence

External link(s) Protein: ENSRNOP00000015913   Gene: ENSRNOG00000039980   Transcript: ENSRNOT00000015085
Sequence length 298
Comment pep:known chromosome:Rnor_5.0:X:123549683:123552808:1 gene:ENSRNOG00000039980 transcript:ENSRNOT00000015085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT
Download sequence
Identical sequences Q09073
ENSRNOP00000015913 10116.ENSRNOP00000015913 ENSRNOP00000015913

Jump to [ Top of page · Domain architecture · Domain assignment details ]