SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSRNOP00000023965 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000023965
Domain Number 1 Region: 517-708
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.28e-51
Family Hemopexin-like domain 2.01e-07
Further Details:      
 
Domain Number 2 Region: 88-216,390-445
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.41e-32
Family Matrix metalloproteases, catalytic domain 1.15e-06
Further Details:      
 
Domain Number 3 Region: 335-391
Classification Level Classification E-value
Superfamily Kringle-like 2.08e-21
Family Fibronectin type II module 0.00015
Further Details:      
 
Domain Number 4 Region: 275-332
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-21
Family Fibronectin type II module 0.00014
Further Details:      
 
Domain Number 5 Region: 219-275
Classification Level Classification E-value
Superfamily Kringle-like 1.4e-20
Family Fibronectin type II module 0.00022
Further Details:      
 
Domain Number 6 Region: 38-105
Classification Level Classification E-value
Superfamily PGBD-like 5.65e-18
Family MMP N-terminal domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000023965
Domain Number - Region: 448-524
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0628
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Protein sequence

External link(s) Protein: ENSRNOP00000023965   Gene: ENSRNOG00000017539   Transcript: ENSRNOT00000023965
Sequence length 708
Comment pep:known chromosome:Rnor_5.0:3:167597817:167605882:1 gene:ENSRNOG00000017539 transcript:ENSRNOT00000023965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPWQPLLLVLLALGYSFAAPHQRQPTYVVFPRDLKTSNLTDTQLAEDYLYRYGYTRAAQ
MMGEKQSLRPALLMLQKQLSLPQTGELDSETLKAIRSPRCGVPDVGKFQTFEGDLKWHHH
NITYWIQSYTEDLPRDVIDDSFARAFAVWSAVTPLTFTRVYGLEADIVIQFGVAEHGDGY
PFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGAVVPTYFGNANGAPCHFPFTFEGR
SYLSCTTDGRNDGKPWCGTTADYDTDRKYGFCPSENLYTEHGNGDGKPCVFPFIFEGHSY
SACTTKGRSDGYRWCATTANYDQDKLYGFCPTRADVTVTGGNSAGEMCVFPFVFLGKQYS
TCTGEGRSDGRLWCATTSNFDADKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALM
YPMYHYHEDSPLHEDDIKGIQHLYGRGSKPDPRPPATTAAEPQPTAPPTMCPTAPPMAYP
TGGPTVAPTGAPSPGPTGPPTAGPSEAPTESSTPVDNPCNVDVFDAIADIQGALHFFKDG
RYWKFSNHGGSQLQGPFLIARTWPALPAKLNSAFEDPQSKKIFFFSGRKMWVYTGQSVLG
PRSLDKLGLGSEVTLVTGLLPRRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFSGV
PWNSHNVFHYQDKAYFCHDKYFWRVSFHNRVNQVDHVAYVTYDLLQCP
Download sequence
Identical sequences D3ZYK8
ENSRNOP00000023965 10116.ENSRNOP00000023965 ENSRNOP00000023965

Jump to [ Top of page · Domain architecture · Domain assignment details ]