SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000023965 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000023965
Domain Number 1 Region: 517-708
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.28e-51
Family Hemopexin-like domain 0.000000201
Further Details:      
 
Domain Number 2 Region: 88-216,390-445
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.41e-32
Family Matrix metalloproteases, catalytic domain 0.00000115
Further Details:      
 
Domain Number 3 Region: 335-391
Classification Level Classification E-value
Superfamily Kringle-like 2.08e-21
Family Fibronectin type II module 0.00015
Further Details:      
 
Domain Number 4 Region: 275-332
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-21
Family Fibronectin type II module 0.00014
Further Details:      
 
Domain Number 5 Region: 219-275
Classification Level Classification E-value
Superfamily Kringle-like 1.4e-20
Family Fibronectin type II module 0.00022
Further Details:      
 
Domain Number 6 Region: 38-105
Classification Level Classification E-value
Superfamily PGBD-like 5.65e-18
Family MMP N-terminal domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000023965
Domain Number - Region: 448-524
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0628
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nuclear outer membrane-endoplasmic reticulum membrane network 1.475 33.33
endoplasmic reticulum part 1.329 33.33
Golgi lumen 2.192 19.32
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21

Protein sequence

External link(s) Protein: ENSRNOP00000023965   Gene: ENSRNOG00000017539   Transcript: ENSRNOT00000023965
Sequence length 708
Comment pep:known chromosome:Rnor_5.0:3:167597817:167605882:1 gene:ENSRNOG00000017539 transcript:ENSRNOT00000023965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPWQPLLLVLLALGYSFAAPHQRQPTYVVFPRDLKTSNLTDTQLAEDYLYRYGYTRAAQ
MMGEKQSLRPALLMLQKQLSLPQTGELDSETLKAIRSPRCGVPDVGKFQTFEGDLKWHHH
NITYWIQSYTEDLPRDVIDDSFARAFAVWSAVTPLTFTRVYGLEADIVIQFGVAEHGDGY
PFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGAVVPTYFGNANGAPCHFPFTFEGR
SYLSCTTDGRNDGKPWCGTTADYDTDRKYGFCPSENLYTEHGNGDGKPCVFPFIFEGHSY
SACTTKGRSDGYRWCATTANYDQDKLYGFCPTRADVTVTGGNSAGEMCVFPFVFLGKQYS
TCTGEGRSDGRLWCATTSNFDADKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALM
YPMYHYHEDSPLHEDDIKGIQHLYGRGSKPDPRPPATTAAEPQPTAPPTMCPTAPPMAYP
TGGPTVAPTGAPSPGPTGPPTAGPSEAPTESSTPVDNPCNVDVFDAIADIQGALHFFKDG
RYWKFSNHGGSQLQGPFLIARTWPALPAKLNSAFEDPQSKKIFFFSGRKMWVYTGQSVLG
PRSLDKLGLGSEVTLVTGLLPRRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFSGV
PWNSHNVFHYQDKAYFCHDKYFWRVSFHNRVNQVDHVAYVTYDLLQCP
Download sequence
Identical sequences D3ZYK8
ENSRNOP00000023965 10116.ENSRNOP00000023965 ENSRNOP00000023965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]