SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSRNOP00000028496 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028496
Domain Number 1 Region: 9-48,99-343
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.44e-74
Family Mitochondrial carrier 0.00053
Further Details:      
 

Protein sequence

External link(s) Protein: ENSRNOP00000028496   Gene: ENSRNOG00000020994   Transcript: ENSRNOT00000028496
Sequence length 359
Comment pep:known chromosome:Rnor_5.0:10:90140265:90144607:-1 gene:ENSRNOG00000020994 transcript:ENSRNOT00000028496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDQDPGGISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPTVASELTTPSRFWSLS
YTKSPSTLQSPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRFTGTLDAFVKIVRHEGT
RTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDLYAPMVAGALARMGTVTVVS
PLELVRTKLQAQHVSYRELAACVQAAVAQGGWRSLWLGWGPTALRDVPFSALYWFNYELV
KSQLNGPRQKEQTSVGISFVAGGISGMVAATLTLPFDVVKTQRQMSLGAVEAMRVKPPRV
DSTWLLLRRIQAESGTRGLFAGFLPRIIKAAPSCAIMISTYEFGKSFFHRLNQEQPLGH
Download sequence
Identical sequences Q4V8K4
ENSRNOP00000028496 10116.ENSRNOP00000028496 ENSRNOP00000028496

Jump to [ Top of page · Domain architecture · Domain assignment details ]