SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSRNOP00000028496 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028496
Domain Number 1 Region: 9-48,99-343
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.44e-74
Family Mitochondrial carrier 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
organelle inner membrane 1.669 61.59
mitochondrial envelope 1.573 58.57
microtubule cytoskeleton 1.341 20.14
spindle 1.789 20.14
plastid 1.6 10.23
chloroplast part 1.896 10.23
ribonucleoprotein complex 1.414 6.87
cytoplasmic ribonucleoprotein granule 1.98 6.87
lipid particle 1.469 4.97
intrinsic component of organelle membrane 2.09 4.87

Protein sequence

External link(s) Protein: ENSRNOP00000028496   Gene: ENSRNOG00000020994   Transcript: ENSRNOT00000028496
Sequence length 359
Comment pep:known chromosome:Rnor_5.0:10:90140265:90144607:-1 gene:ENSRNOG00000020994 transcript:ENSRNOT00000028496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDQDPGGISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPTVASELTTPSRFWSLS
YTKSPSTLQSPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRFTGTLDAFVKIVRHEGT
RTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDLYAPMVAGALARMGTVTVVS
PLELVRTKLQAQHVSYRELAACVQAAVAQGGWRSLWLGWGPTALRDVPFSALYWFNYELV
KSQLNGPRQKEQTSVGISFVAGGISGMVAATLTLPFDVVKTQRQMSLGAVEAMRVKPPRV
DSTWLLLRRIQAESGTRGLFAGFLPRIIKAAPSCAIMISTYEFGKSFFHRLNQEQPLGH
Download sequence
Identical sequences Q4V8K4
ENSRNOP00000028496 10116.ENSRNOP00000028496 ENSRNOP00000028496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]