SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSRNOP00000037549 from Rattus norvegicus 73_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000037549
Domain Number 1 Region: 334-528
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.85e-63
Family Hemopexin-like domain 5.33e-06
Further Details:      
 
Domain Number 2 Region: 101-293
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.45e-44
Family Matrix metalloproteases, catalytic domain 4.95e-05
Further Details:      
 
Domain Number 3 Region: 41-114
Classification Level Classification E-value
Superfamily PGBD-like 4.71e-17
Family MMP N-terminal domain 0.0037
Further Details:      
 

Protein sequence

External link(s) Protein: ENSRNOP00000037549   Gene: ENSRNOG00000023643   Transcript: ENSRNOT00000035881
Sequence length 587
Comment pep:known chromosome:Rnor_5.0:12:32636907:32663678:-1 gene:ENSRNOG00000023643 transcript:ENSRNOT00000035881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRPRGPGSPRGPGPPRPGPGLPPLLLMLALAAHGGCAAPAPRAEDLSLGVEWLSKFGY
LPPADPATGQLQTQEELSKAITAMQQFGGLETTGILDEATLALMKTPRCSLPDLPLGAQS
RRRRQTPLPTKWSKRNLSWRVRTFPRDSPLGRDTVRALMYYALKVWSDITPLNFHEVAGN
MADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGDHHTAGDTHFDDDEAWTFRSSDAHGMD
LFAVAVHEFGHAIGLSHVAAPSSIMQPYYQGPVGDPLRYGLPYEDRVRVWQLYGVRESVS
PTAQLDTPEPEEPPLLPEPPNNRSSTPPQKDVPHRCTAHFDAVAQIRGEAFFFKGKYFWR
LTRDRHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDNNVEEG
YPRPVSDFSLPPGGIDAVFSWAHNDRTYFFKDQLYWRYDDHTRRMDPGYPAQGPLWRGVP
SVLDDAMRWSDGASYFFRGQEYWKVLDGELEAAPGYPQSTARDWLVCGEQLADAEDVGPG
PQGRSGAQDGLAVCSCTSDAHRSALPPLLLLPPLLWGLWTSVSSTAS
Download sequence
Identical sequences D3ZXJ0
ENSRNOP00000037549 10116.ENSRNOP00000037549 ENSRNOP00000037549

Jump to [ Top of page · Domain architecture · Domain assignment details ]