SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000056892 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056892
Domain Number 1 Region: 30-294
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.09e-44
Family Mitochondrial carrier 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
mitochondrial envelope 1.596 75.11
organelle inner membrane 1.689 73.99
microtubule cytoskeleton 1.399 25.19
plastid 1.489 10.36
integral component of organelle membrane 2.008 8.69
microbody 1.813 7.6
intracellular ribonucleoprotein complex 1.329 7.58
cytoplasmic ribonucleoprotein granule 1.891 7.58
outer membrane 2.082 6.12

Protein sequence

External link(s) Protein: ENSRNOP00000056892   Gene: ENSRNOG00000039278   Transcript: ENSRNOT00000060149
Sequence length 298
Comment pep:known chromosome:Rnor_5.0:5:65629577:65637295:-1 gene:ENSRNOG00000039278 transcript:ENSRNOT00000060149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGSEAHDKRPPMLTSSNQDLSPHLADVGQIKHYFCGCCAAFNNVAITYPVQKILFRQQL
YGIKTRDAILQLRKDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSRLLRKHVSNAPEFA
TRSVAALLAGTTEAILTPLERVQTLLQDHKHHDKFTNTYQAFRALRCHGVAEYYRGLVPI
LFRNGFSNILFFGLRGPIKEHLPTATTNSEHLVNDFICGGVLGAMLGFLSFPVNVVKARI
QSQIGGPFQSLPMVFKTIWIERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKIV
Download sequence
Identical sequences C0PBR3 Q52KK3
10116.ENSRNOP00000056892 ENSRNOP00000056892 ENSRNOP00000056892 ENSRNOP00000065025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]