SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSRNOP00000056892 from Rattus norvegicus 73_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000056892
Domain Number 1 Region: 30-294
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.09e-44
Family Mitochondrial carrier 0.0016
Further Details:      
 

Protein sequence

External link(s) Protein: ENSRNOP00000056892   Gene: ENSRNOG00000039278   Transcript: ENSRNOT00000060149
Sequence length 298
Comment pep:known chromosome:Rnor_5.0:5:65629577:65637295:-1 gene:ENSRNOG00000039278 transcript:ENSRNOT00000060149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGSEAHDKRPPMLTSSNQDLSPHLADVGQIKHYFCGCCAAFNNVAITYPVQKILFRQQL
YGIKTRDAILQLRKDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSRLLRKHVSNAPEFA
TRSVAALLAGTTEAILTPLERVQTLLQDHKHHDKFTNTYQAFRALRCHGVAEYYRGLVPI
LFRNGFSNILFFGLRGPIKEHLPTATTNSEHLVNDFICGGVLGAMLGFLSFPVNVVKARI
QSQIGGPFQSLPMVFKTIWIERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKIV
Download sequence
Identical sequences C0PBR3 Q52KK3
ENSRNOP00000056892 10116.ENSRNOP00000056892 ENSRNOP00000056892 ENSRNOP00000065025

Jump to [ Top of page · Domain architecture · Domain assignment details ]