SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|21151|e_gw1.2.968.1 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|21151|e_gw1.2.968.1
Domain Number 1 Region: 334-601
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-81
Family Protein kinases, catalytic subunit 0.00000106
Further Details:      
 
Domain Number 2 Region: 6-105
Classification Level Classification E-value
Superfamily Doublecortin (DC) 1.83e-25
Family Doublecortin (DC) 0.0000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|21151|e_gw1.2.968.1
Sequence length 669
Sequence
MPYRDNERRTVKVKFYKNGDQYFQGLPMNISINRYRSMEALLNELTRSISLPRGVRYVMT
PDNGKKIQSVHELQDGKAYICSSFNSLSKIEYGKAARPAWRPNTKLAPLEIMEEVRNLPG
NNGSISHGASSFGNKKPILKPIGQEKNNPQSHQPVKTDDSTKRASRNRVADTADISRVSN
ANDLTKSSNNKLADTTQKSRASSDTLSEKMPLTNQNIEKDTYENEKDIDESEKNEDQVDK
QASNDDIFSPVKDTVTDGDVDTHSEKMPLTNQNIEKDIDENEKDFNESEKDIDENPATPV
KLGDTFINKVNNENINKSAGRNTPENNEPLPNREGTYEDYYVKGNIIGDGNFAEVFHCVE
QDTLVEYALKLVHKSKIKGKESMIQDEINIMKKCRHKNIIRLIEVFDTQIEIQLVMELVK
GGDLFDLISDVSKFTEFEASGLIGDLAAALQYLHKRSIIHRDLKPENLLITQNFDDTFTL
KLGDFGLAVVVTEPLFQICGTPTYLAPEVLAETGYGLPADMWATGVINYIVLCGFPPFRS
KDRNQNELFNIIKKGEFEYLSPYWDDISDTATDLVDNLLMVNPVDRYTAEQVLKHPWIVN
RAGSISDVDLKDNITNNIRENFDPKKSFKAAALAVRTAKLLDQTVESRAESRQDNDDDIF
GGDDEDFGL
Download sequence
Identical sequences B3RPN0
jgi|Triad1|21151|e_gw1.2.968.1 10228.JGI21151 XP_002109497.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]