SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000004544 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004544
Domain Number 1 Region: 100-264
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.08e-56
Family Matrix metalloproteases, catalytic domain 0.0000000558
Further Details:      
 
Domain Number 2 Region: 26-95
Classification Level Classification E-value
Superfamily PGBD-like 1.1e-19
Family MMP N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.358 15.67
cell surface 1.26 11.29
neuron projection terminus 2.098 10.13
exocytic vesicle 2.005 10.08
organelle subcompartment 1.51 9.21
Golgi membrane 1.579 9.21
trans-Golgi network 2.053 9.21
lytic vacuole 1.528 8.74
vacuolar part 1.508 7.04
presynapse 1.761 5.66

Protein sequence

External link(s) Protein: ENSMMUP00000004544   Gene: ENSMMUG00000003405   Transcript: ENSMMUT00000004818
Sequence length 270
Comment pep:known chromosome:MMUL_1:14:101110166:101120818:-1 gene:ENSMMUG00000003405 transcript:ENSMMUT00000004818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMRLTVLCAVCLLPGSLALPLPREAGGMSELQWKQAQDYLKRFYLYDSETKNANSLEA
KLKEMEKFFGLPITGMLNSRIIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYT
RDLPHFTVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDPYPFDGPGNTLA
HAFAPGPGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYG
NGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Download sequence
Identical sequences F7FE85 G7PNJ9
ENSMMUP00000004544 9544.ENSMMUP00000004544 ENSMMUP00000004544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]