SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMMUP00000004544 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000004544
Domain Number 1 Region: 100-264
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.08e-56
Family Matrix metalloproteases, catalytic domain 5.58e-08
Further Details:      
 
Domain Number 2 Region: 26-95
Classification Level Classification E-value
Superfamily PGBD-like 1.1e-19
Family MMP N-terminal domain 0.0011
Further Details:      
 

Protein sequence

External link(s) Protein: ENSMMUP00000004544   Gene: ENSMMUG00000003405   Transcript: ENSMMUT00000004818
Sequence length 270
Comment pep:known chromosome:MMUL_1:14:101110166:101120818:-1 gene:ENSMMUG00000003405 transcript:ENSMMUT00000004818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMRLTVLCAVCLLPGSLALPLPREAGGMSELQWKQAQDYLKRFYLYDSETKNANSLEA
KLKEMEKFFGLPITGMLNSRIIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYT
RDLPHFTVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDPYPFDGPGNTLA
HAFAPGPGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYG
NGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
Download sequence
Identical sequences F7FE85 G7PNJ9
9544.ENSMMUP00000004544 ENSMMUP00000004544 ENSMMUP00000004544

Jump to [ Top of page · Domain architecture · Domain assignment details ]