SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMMUP00000005982 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005982
Domain Number 1 Region: 273-464
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.62e-66
Family Hemopexin-like domain 3.84e-07
Further Details:      
 
Domain Number 2 Region: 100-264
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.15e-57
Family Matrix metalloproteases, catalytic domain 1.39e-07
Further Details:      
 
Domain Number 3 Region: 32-95
Classification Level Classification E-value
Superfamily PGBD-like 4.71e-20
Family MMP N-terminal domain 0.00032
Further Details:      
 

Protein sequence

External link(s) Protein: ENSMMUP00000005982   Gene: ENSMMUG00000004489   Transcript: ENSMMUT00000006359
Sequence length 467
Comment pep:known_by_projection chromosome:MMUL_1:14:101328800:101340954:-1 gene:ENSMMUG00000004489 transcript:ENSMMUT00000006359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLKMLLFLLLLHVQISKAFPVSSKEENTKIVQDYLEKFYQLPSNQYQSTRKNGTSMIV
EKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGDFMLTPGNPKWERTNLTYSILNY
TPQLSETDVEGAIKKAFEVWSKASPLTFTRISQGQADINIAFFQRDHGDNSPFDGPNGIL
AHAFQPGQGIGGDAHFDAEETWTKTSTNYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYA
FRETSNYSLPQDDINGIQAIYGPSSNPIQPTGPSTPKSCDPRLTFDAITTLRGEILFFKD
EYFWRRHPHLQSVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYWAVSGYDIQQG
YPRDISNYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGTFPGI
ENKVDAVFQQEHFFLFFSGPRYYAFDLIAERVTRVARANKWLNCRYS
Download sequence
Identical sequences F7GG37
9544.ENSMMUP00000005982 ENSMMUP00000005982 ENSMMUP00000005982

Jump to [ Top of page · Domain architecture · Domain assignment details ]