SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMMUP00000005982 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000005982
Domain Number 1 Region: 273-464
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.62e-66
Family Hemopexin-like domain 0.000000384
Further Details:      
 
Domain Number 2 Region: 100-264
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.15e-57
Family Matrix metalloproteases, catalytic domain 0.000000139
Further Details:      
 
Domain Number 3 Region: 32-95
Classification Level Classification E-value
Superfamily PGBD-like 4.71e-20
Family MMP N-terminal domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
brush border 1.477 22.56
Golgi lumen 2.24 12.25
secretory granule 1.818 10.6
neuron projection terminus 2.132 10.38
lysosomal membrane 1.986 8.14
trans-Golgi network 1.793 7.96
lytic vacuole 1.571 7.43
vacuolar part 1.621 7.24
dendrite 1.585 7.21
transferase complex 1.423 5.58
Molecular Function IC (bits) H-Score
endopeptidase activity 1.536 148.91
metalloendopeptidase activity 2.043 148.91
zinc ion binding 1.65 43.49
integrin binding 1.779 17.72
growth factor receptor binding 1.998 15.09
cytokine receptor binding 2.036 15.09
enzyme activator activity 1.376 14.48
amide binding 1.716 13.08
cell adhesion molecule binding 1.514 11.59
collagen binding 1.844 5.54

Protein sequence

External link(s) Protein: ENSMMUP00000005982   Gene: ENSMMUG00000004489   Transcript: ENSMMUT00000006359
Sequence length 467
Comment pep:known_by_projection chromosome:MMUL_1:14:101328800:101340954:-1 gene:ENSMMUG00000004489 transcript:ENSMMUT00000006359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLKMLLFLLLLHVQISKAFPVSSKEENTKIVQDYLEKFYQLPSNQYQSTRKNGTSMIV
EKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGDFMLTPGNPKWERTNLTYSILNY
TPQLSETDVEGAIKKAFEVWSKASPLTFTRISQGQADINIAFFQRDHGDNSPFDGPNGIL
AHAFQPGQGIGGDAHFDAEETWTKTSTNYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYA
FRETSNYSLPQDDINGIQAIYGPSSNPIQPTGPSTPKSCDPRLTFDAITTLRGEILFFKD
EYFWRRHPHLQSVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYWAVSGYDIQQG
YPRDISNYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGTFPGI
ENKVDAVFQQEHFFLFFSGPRYYAFDLIAERVTRVARANKWLNCRYS
Download sequence
Identical sequences F7GG37
ENSMMUP00000005982 ENSMMUP00000005982 9544.ENSMMUP00000005982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]