SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013874 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013874
Domain Number 1 Region: 3-87
Classification Level Classification E-value
Superfamily Acyl-CoA binding protein 6.67e-29
Family Acyl-CoA binding protein 0.0000474
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013874   Gene: ENSMMUG00000010587   Transcript: ENSMMUT00000014809
Sequence length 88
Comment pep:known chromosome:MMUL_1:9:15374540:15385815:-1 gene:ENSMMUG00000010587 transcript:ENSMMUT00000014809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIIGDINIECPGMLDLKGKAKWEAW
NLKKGLSTEDAMSAYISKAKELIEKYGI
Download sequence
Identical sequences A0A1D5QHH2 A0A2I3M752 A0A2K5MC95 A0A2K6BJB7 A0A2K6LGD0 A0A2K6R6N9 I7GDY8
ENSMMUP00000013874 9544.ENSMMUP00000013874 NP_001245104.1.72884 XP_008000550.1.81039 XP_011716728.1.29376 XP_011911404.1.92194 XP_015001964.1.72884 XP_015311077.1.63531 XP_017729729.1.44346 ENSPANP00000019920 ENSMMUP00000013874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]