SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMMUP00000013874 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013874
Domain Number 1 Region: 3-87
Classification Level Classification E-value
Superfamily Acyl-CoA binding protein 6.67e-29
Family Acyl-CoA binding protein 0.0000474
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microbody 1.95 9
Molecular Function IC (bits) H-Score
sulfur compound binding 1.451 34.37
cofactor binding 1.605 28.82
isomerase activity 1.67 18.72
intramolecular oxidoreductase activity 2.161 7.4

Protein sequence

External link(s) Protein: ENSMMUP00000013874   Gene: ENSMMUG00000010587   Transcript: ENSMMUT00000014809
Sequence length 88
Comment pep:known chromosome:MMUL_1:9:15374540:15385815:-1 gene:ENSMMUG00000010587 transcript:ENSMMUT00000014809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIIGDINIECPGMLDLKGKAKWEAW
NLKKGLSTEDAMSAYISKAKELIEKYGI
Download sequence
Identical sequences F7CHP3 I7GDY8
ENSMMUP00000013874 ENSPANP00000019920 9544.ENSMMUP00000013874 ENSMMUP00000013874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]