SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013874 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013874
Domain Number 1 Region: 3-87
Classification Level Classification E-value
Superfamily Acyl-CoA binding protein 6.67e-29
Family Acyl-CoA binding protein 0.0000474
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
monocarboxylic acid metabolic process 1.419 10.62
oxidation-reduction process 1.409 9.25
lipid modification 1.92 9.25
lipid transport 1.874 7.37
response to oxygen levels 1.503 6.4
maintenance of location 1.483 5.22
response to radiation 1.552 4.37
cellular lipid catabolic process 1.96 3.95
Cellular Component IC (bits) H-Score
microbody 1.816 12.58
Molecular Function IC (bits) H-Score
cofactor binding 1.549 26.61
intramolecular oxidoreductase activity 2.097 10.87
isomerase activity 1.598 5.58

Protein sequence

External link(s) Protein: ENSMMUP00000013874   Gene: ENSMMUG00000010587   Transcript: ENSMMUT00000014809
Sequence length 88
Comment pep:known chromosome:MMUL_1:9:15374540:15385815:-1 gene:ENSMMUG00000010587 transcript:ENSMMUT00000014809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIIGDINIECPGMLDLKGKAKWEAW
NLKKGLSTEDAMSAYISKAKELIEKYGI
Download sequence
Identical sequences F7CHP3 I7GDY8
9544.ENSMMUP00000013874 ENSMMUP00000013874 ENSPANP00000019920 ENSMMUP00000013874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]