SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for ENSMMUP00000013874 from Macaca mulatta 71_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013874
Domain Number 1 Region: 3-87
Classification Level Classification E-value
Superfamily Acyl-CoA binding protein 6.67e-29
Family Acyl-CoA binding protein 4.74e-05
Further Details:      
 

Protein sequence

External link(s) Protein: ENSMMUP00000013874   Gene: ENSMMUG00000010587   Transcript: ENSMMUT00000014809
Sequence length 88
Comment pep:known chromosome:MMUL_1:9:15374540:15385815:-1 gene:ENSMMUG00000010587 transcript:ENSMMUT00000014809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIIGDINIECPGMLDLKGKAKWEAW
NLKKGLSTEDAMSAYISKAKELIEKYGI
Download sequence
Identical sequences F7CHP3 I7GDY8
9544.ENSMMUP00000013874 ENSMMUP00000013874 ENSMMUP00000013874

Jump to [ Top of page · Domain architecture · Domain assignment details ]