SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for Q0010 from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: Q0010   Protein: S000007257
Sequence length 128
Comment Q0010 SGDID:S000007257, Chr Mito from 3952-4338, Dubious ORF, "Dubious mitochondrial open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the dubious ORF Q0017"
Sequence
MYYIMFLYNMLLIIILIFYSIVGVPIIIFNNNYYWDPDIFLFIIYYFIKFIIIFNLYLYY
MINYIVYTPSGSPPGRGTYILLYNMLYSYNMFIDYVMKFITCVTYMYLMFWLLSPTPSPY
YVSEVPVS
Download sequence
Identical sequences Q9ZZX9
Q0010 4932.Q0010 Q0010 Q0010

Jump to [ Top of page · Domain architecture · Domain assignment details ]