SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for Q0010 from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: Q0010   Protein: S000007257
Sequence length 128
Comment Q0010 SGDID:S000007257, Chr Mito from 3952-4338, Dubious ORF, "Dubious mitochondrial open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the dubious ORF Q0017"
Sequence
MYYIMFLYNMLLIIILIFYSIVGVPIIIFNNNYYWDPDIFLFIIYYFIKFIIIFNLYLYY
MINYIVYTPSGSPPGRGTYILLYNMLYSYNMFIDYVMKFITCVTYMYLMFWLLSPTPSPY
YVSEVPVS
Download sequence
Identical sequences Q9ZZX9
Q0010 4932.Q0010 Q0010 Q0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]