SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for Q0032 from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: Q0032   Protein: S000007259
Sequence length 96
Comment Q0032 SGDID:S000007259, Chr Mito from 11667-11957, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MLMMYMLFIMMKTYPMLSYHMMSYHIMLYTIMWYMKYSTYMRLWLLYKSYFIFIFIWTNN
NYNNNYWYVTMLMNTYLYYNMNIHFLTINKKFLYSL
Download sequence
Identical sequences Q9ZZX7
Q0032 4932.Q0032 Q0032 4155 Q0032

Jump to [ Top of page · Domain architecture · Domain assignment details ]