SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for Q0032 from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: Q0032   Protein: S000007259
Sequence length 96
Comment Q0032 SGDID:S000007259, Chr Mito from 11667-11957, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MLMMYMLFIMMKTYPMLSYHMMSYHIMLYTIMWYMKYSTYMRLWLLYKSYFIFIFIWTNN
NYNNNYWYVTMLMNTYLYYNMNIHFLTINKKFLYSL
Download sequence
Identical sequences Q9ZZX7
Q0032 Q0032 4155 Q0032 4932.Q0032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]