SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for Q0050 from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0050
Domain Number 1 Region: 270-464,514-582
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.66e-43
Family Reverse transcriptase 0.045
Further Details:      
 
Domain Number 2 Region: 3-148
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit I-like 0.00000000000497
Family Cytochrome c oxidase subunit I-like 0.001
Further Details:      
 
Weak hits

Sequence:  Q0050
Domain Number - Region: 226-286
Classification Level Classification E-value
Superfamily L domain-like 0.0287
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
respiratory chain 2.141 140.38
replication fork 2.208 36.93
DNA repair complex 2.141 17.94
mitochondrial matrix 1.714 9.49
transferase complex 1.423 8.07
mitochondrial envelope 1.573 7.87
chromosomal part 1.477 7.16
ribonucleoprotein complex 1.414 7.1
nuclear chromosome 1.73 5.86
organelle inner membrane 1.669 5.04

Protein sequence

External link(s) Locus: Q0050   Protein: S000007261
Sequence length 834
Comment AI1 SGDID:S000007261, Chr Mito from 13818-16322, Verified ORF, "Reverse transcriptase required for splicing of the COX1 pre-mRNA, encoded by a mobile group II intron within the mitochondrial COX1 gene"
Sequence
MVQRWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNGAPT
SAYISLMRTALVLWIINRYLKHMTNSVGANFTGTMACHKTPMISVGGVKCYMVRLTNFLQ
VFIRITISSYHLDMVKQVWLFYVEVIRLWFIVLDSTGSVKKMKDTNNTKGNTKSEGSTER
GNSGVDRGMVVPNTQMKMRFLNQVRYYSVNNNLKMGKDTNIELSKDTSTSDLLEFEKLVM
DNMNEENMNNNLLSIMKNVDMLMLAYNRIKSKPGNMTPGTTLETLDGMNMMYLNKLSNEL
GTGKFKFKPMRMVNIPKPKGGMRPLSVGNPRDKIVQEVMRMILDTIFDKKMSTHSHGFRK
NMSCQTAIWEVRNMFGGSNWFIEVDLKKCFDTISHDLIIKELKRYISDKGFIDLVYKLLR
AGYIDEKGTYHKPMLGLPQGSLISPILCNIVMTLVDNWLEDYINLYNKGKVKKQHPTYKK
LSRMIAKAKMFSTRLKLHKERAKGPTFIYNDPNFKRMKYVRYADDILIGVLGSKNDCKMI
KRDLNNFLNSLGLTMNEEKTLITCATETPARFLGYNISITPLKRMPTVTKTIRGKTIRSR
NTTRPIINAPIRDIINKLATNGYCKHNKNGRMGVPTRVGRWTYEEPRTIINNYKALGRGI
LNYYKLATNYKRLRERIYYVLYYSCVLTLASKYRLKTMSKTIKKFGYNLNIIENDKLIAN
FPRNTFDNIKKIENHGMFMYMSEAKVTDPFEYIDSIKYMLPTAKANFNKPCSICNSTIDV
EMHHVKQLHRGMLKATKDYITGRMITMNRKQIPLCKQCHIKTHKNKFKNMGPGM
Download sequence
Identical sequences P03875
4932.Q0050 YR101 Q0050 Q0050 Q0050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]