SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for Q0050 from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0050
Domain Number 1 Region: 270-464,514-582
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.66e-43
Family Reverse transcriptase 0.045
Further Details:      
 
Domain Number 2 Region: 3-148
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit I-like 4.97e-12
Family Cytochrome c oxidase subunit I-like 0.001
Further Details:      
 
Weak hits

Sequence:  Q0050
Domain Number - Region: 226-286
Classification Level Classification E-value
Superfamily L domain-like 0.0287
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.084
Further Details:      
 

Most Informative Gene Ontologies

Protein sequence

External link(s) Locus: Q0050   Protein: S000007261
Sequence length 834
Comment AI1 SGDID:S000007261, Chr Mito from 13818-16322, Verified ORF, "Reverse transcriptase required for splicing of the COX1 pre-mRNA, encoded by a mobile group II intron within the mitochondrial COX1 gene"
Sequence
MVQRWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNGAPT
SAYISLMRTALVLWIINRYLKHMTNSVGANFTGTMACHKTPMISVGGVKCYMVRLTNFLQ
VFIRITISSYHLDMVKQVWLFYVEVIRLWFIVLDSTGSVKKMKDTNNTKGNTKSEGSTER
GNSGVDRGMVVPNTQMKMRFLNQVRYYSVNNNLKMGKDTNIELSKDTSTSDLLEFEKLVM
DNMNEENMNNNLLSIMKNVDMLMLAYNRIKSKPGNMTPGTTLETLDGMNMMYLNKLSNEL
GTGKFKFKPMRMVNIPKPKGGMRPLSVGNPRDKIVQEVMRMILDTIFDKKMSTHSHGFRK
NMSCQTAIWEVRNMFGGSNWFIEVDLKKCFDTISHDLIIKELKRYISDKGFIDLVYKLLR
AGYIDEKGTYHKPMLGLPQGSLISPILCNIVMTLVDNWLEDYINLYNKGKVKKQHPTYKK
LSRMIAKAKMFSTRLKLHKERAKGPTFIYNDPNFKRMKYVRYADDILIGVLGSKNDCKMI
KRDLNNFLNSLGLTMNEEKTLITCATETPARFLGYNISITPLKRMPTVTKTIRGKTIRSR
NTTRPIINAPIRDIINKLATNGYCKHNKNGRMGVPTRVGRWTYEEPRTIINNYKALGRGI
LNYYKLATNYKRLRERIYYVLYYSCVLTLASKYRLKTMSKTIKKFGYNLNIIENDKLIAN
FPRNTFDNIKKIENHGMFMYMSEAKVTDPFEYIDSIKYMLPTAKANFNKPCSICNSTIDV
EMHHVKQLHRGMLKATKDYITGRMITMNRKQIPLCKQCHIKTHKNKFKNMGPGM
Download sequence
Identical sequences P03875
Q0050 4932.Q0050 Q0050 YR101 Q0050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]