SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for Q0110 from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0110
Domain Number 1 Region: 211-420
Classification Level Classification E-value
Superfamily Homing endonucleases 8.5e-62
Family Group I mobile intron endonuclease 0.00054
Further Details:      
 
Domain Number 2 Region: 3-173
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.32e-54
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 6.91e-08
Further Details:      
 

Protein sequence

External link(s) Locus: Q0110   Protein: S000007271
Sequence length 423
Comment BI2 SGDID:S000007271, Chr Mito from 36540-36954,37723-38579, Verified ORF, "Mitochondrial mRNA maturase with a role in splicing, encoded by both exon and intron sequences of partially processed COB mRNA"
Sequence
MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIEL
AFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVII
FILTIATAFLGYCCVYGQMSHWGNMNIASNMFNMMKTIYMMMLMLLIYIFYTIMMRQMMK
TKEYTMLIKSMDYINKNKYMINLNMTNKKDMNNNIGPLNMNILSIIYGSMLGDGHAEKRK
GGKGTRIVFQQEYCNINYLYYLHSLLANLGYCNTNLPLIKTRLGKKGKIRQYLKFNTWTY
DSFNMIYSEWYIKNMSGKGNIKVIPKSLDNYLTPLALAIWIMDDGCKLGKGLKFTTNCFS
YKDVQYLTYLLHNKYNIKSTITKGNKENTQFVIYVWKESMPILTKIVSPYIIPSMKYKLG
NYL
Download sequence
Identical sequences P03873
Q0110 4932.Q0110 Q0110 Q0110

Jump to [ Top of page · Domain architecture · Domain assignment details ]