SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for Q0110 from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0110
Domain Number 1 Region: 211-420
Classification Level Classification E-value
Superfamily Homing endonucleases 8.5e-62
Family Group I mobile intron endonuclease 0.00054
Further Details:      
 
Domain Number 2 Region: 3-173
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.32e-54
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 6.91e-08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
respiratory chain 2.14 9.53
mitochondrial inner membrane 1.751 8.36
mitochondrial membrane part 1.917 7.6
organelle inner membrane 1.672 7.42
mitochondrial envelope 1.57 6.94

Protein sequence

External link(s) Locus: Q0110   Protein: S000007271
Sequence length 423
Comment BI2 SGDID:S000007271, Chr Mito from 36540-36954,37723-38579, Verified ORF, "Mitochondrial mRNA maturase with a role in splicing, encoded by both exon and intron sequences of partially processed COB mRNA"
Sequence
MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIEL
AFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVII
FILTIATAFLGYCCVYGQMSHWGNMNIASNMFNMMKTIYMMMLMLLIYIFYTIMMRQMMK
TKEYTMLIKSMDYINKNKYMINLNMTNKKDMNNNIGPLNMNILSIIYGSMLGDGHAEKRK
GGKGTRIVFQQEYCNINYLYYLHSLLANLGYCNTNLPLIKTRLGKKGKIRQYLKFNTWTY
DSFNMIYSEWYIKNMSGKGNIKVIPKSLDNYLTPLALAIWIMDDGCKLGKGLKFTTNCFS
YKDVQYLTYLLHNKYNIKSTITKGNKENTQFVIYVWKESMPILTKIVSPYIIPSMKYKLG
NYL
Download sequence
Identical sequences P03873
Q0110 4932.Q0110 Q0110 Q0110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]