SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for Q0130 from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0130
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 3.27e-19
Family F1F0 ATP synthase subunit C 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
vacuolar part 1.621 33.31
mitochondrial envelope 1.573 10.28
organelle inner membrane 1.669 7.52
mitochondrial membrane part 1.917 5.8

Protein sequence

External link(s) Locus: Q0130   Protein: S000007274
Sequence length 76
Comment OLI1 SGDID:S000007274, Chr Mito from 46723-46953, Verified ORF, "F0-ATP synthase subunit 9 (ATPase-associated proteolipid), encoded on the mitochondrial genome; mutation confers oligomycin resistance; expression is specifically dependent on the nuclear genes AEP1 and AEP2"
Sequence
MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPMAILGFALSEA
TGLFCLMVSFLLLFGV
Download sequence
Identical sequences A7LCN9 C0J5P5 C7GM63 D2XZ10 G2HKE8 P61828 P61829 Q6LAG6 Q6LAG8 Q71U77 Q71U79 Q71U82 Q71U86 Q71U87 Q71U90
4932.Q0130 Q0130 Q0130 2wpd.J 2wpd.K 2wpd.L 2wpd.M 2wpd.N 2wpd.O 2wpd.P 2wpd.Q 2wpd.R 2wpd.S 2xok.K 2xok.L 2xok.M 2xok.N 2xok.O 2xok.P 2xok.Q 2xok.R 2xok.S 2xok.T 3u2f.K 3u2f.L 3u2f.M 3u2f.N 3u2f.O 3u2y.K 3u2y.L 3u2y.M 3u2y.N 3u2y.O 3u32.K 3u32.L 3u32.M 3u32.N 3u32.O 3ud0.K 3ud0.L 3ud0.M 3ud0.N 3ud0.O 3zry.J 3zry.K 3zry.L 3zry.M 3zry.N 3zry.O 3zry.P 3zry.Q 3zry.R 3zry.S 4b2q.J 4b2q.K 4b2q.L 4b2q.M 4b2q.N 4b2q.O 4b2q.P 4b2q.Q 4b2q.R 4b2q.S 4b2q.j 4b2q.k 4b2q.l 4b2q.m 4b2q.n 4b2q.o 4b2q.p 4b2q.q 4b2q.r 4b2q.s 4f4s.A 4f4s.B 4f4s.C 4f4s.D 4f4s.E 4f4s.K 4f4s.L 4f4s.M 4f4s.N 4f4s.O tr|A7LCN9|A7LCN9_YEAS7 Q0130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]