SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for Q0297 from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: Q0297   Protein: S000007284
Sequence length 51
Comment Q0297 SGDID:S000007284, Chr Mito from 85554-85709, Dubious ORF, "Dubious open reading frame of the mitochondrial genome; unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified gene RPM1"
Sequence
MKMKTNKYMNMVRPAPPRRADPEGVRDPSTMGGGPNPFLRRSPYMYINKKK
Download sequence
Identical sequences Q9ZZV8
4932.Q0297 Q0297 Q0297 Q0297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]