SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for Q0297 from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: Q0297   Protein: S000007284
Sequence length 51
Comment Q0297 SGDID:S000007284, Chr Mito from 85554-85709, Dubious ORF, "Dubious open reading frame of the mitochondrial genome; unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified gene RPM1"
Sequence
MKMKTNKYMNMVRPAPPRRADPEGVRDPSTMGGGPNPFLRRSPYMYINKKK
Download sequence
Identical sequences Q9ZZV8
Q0297 4932.Q0297 Q0297 Q0297

Jump to [ Top of page · Domain architecture · Domain assignment details ]