SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for R0010W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0010W
Domain Number 1 Region: 136-422
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 7.53e-121
Family Lambda integrase-like, catalytic core 0.0000000000381
Further Details:      
 
Domain Number 2 Region: 2-129
Classification Level Classification E-value
Superfamily lambda integrase-like, N-terminal domain 2.35e-83
Family lambda integrase-like, N-terminal domain 0.000000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cell body 1.492 12.83
chromosomal part 1.478 6.29
Biological Process IC (bits) H-Score
cell division 1.6 25.68
viral process 1.843 12.92
chromatin organization 1.566 11.91
chromatin remodeling 2.047 11.91
circadian rhythm 1.896 10.17
rhythmic process 1.656 8.24
multi-organism cellular process 1.739 8.15
DNA conformation change 1.678 4.54
interspecies interaction between organisms 1.586 3.6

Protein sequence

External link(s) Locus: R0010W   Protein: S000029654
Sequence length 423
Comment FLP1 SGDID:S000029654, 2-micron plasmid from 252-1523, Verified ORF, "Site-specific recombinase encoded on the 2-micron plasmid, required for 2-micron plasmid propagation as part of a plasmid amplification system that compensates for any copy number decreases caused by missegregation events"
Sequence
MPQFGILCKTPPKVLVRQFVERFERPSGEKIALCAAELTYLCWMITHNGTAIKRATFMSY
NTIISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWEFTIIPYYGQKHQSDITDIV
SSLQLQFESSEEADKGNSHSKKMLKALLSEGESIWEITEKILNSFEYTSRFTKTKTLYQF
LFLATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTETKTSVSRHIYFFSARGRID
PLVYLDEFLRNSEPVLKRVNRTGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKN
GPKSHIGRHLMTSFLSMKGLTELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSR
YYAYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYIN
RRI
Download sequence
Identical sequences P03870
4932.R0010W R0010W gi|11466068|ref|NP_040488.1|NC_001398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]