SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for R0010W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0010W
Domain Number 1 Region: 136-422
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 7.53e-121
Family Lambda integrase-like, catalytic core 3.81e-11
Further Details:      
 
Domain Number 2 Region: 2-129
Classification Level Classification E-value
Superfamily lambda integrase-like, N-terminal domain 2.35e-83
Family lambda integrase-like, N-terminal domain 2.13e-07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
isomerase activity 1.671 27.57
chromatin binding 1.699 5.37
Cellular Component IC (bits) H-Score
cell body 1.495 12.92
chromosomal part 1.477 6.29
Biological Process IC (bits) H-Score
cell division 1.6 25.85
viral process 1.843 13.07
multi-organism cellular process 1.736 8.28
DNA conformation change 1.678 4.55
interspecies interaction between organisms 1.593 3.61

Protein sequence

External link(s) Locus: R0010W   Protein: S000029654
Sequence length 423
Comment FLP1 SGDID:S000029654, 2-micron plasmid from 252-1523, Verified ORF, "Site-specific recombinase encoded on the 2-micron plasmid, required for 2-micron plasmid propagation as part of a plasmid amplification system that compensates for any copy number decreases caused by missegregation events"
Sequence
MPQFGILCKTPPKVLVRQFVERFERPSGEKIALCAAELTYLCWMITHNGTAIKRATFMSY
NTIISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWEFTIIPYYGQKHQSDITDIV
SSLQLQFESSEEADKGNSHSKKMLKALLSEGESIWEITEKILNSFEYTSRFTKTKTLYQF
LFLATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTETKTSVSRHIYFFSARGRID
PLVYLDEFLRNSEPVLKRVNRTGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKN
GPKSHIGRHLMTSFLSMKGLTELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSR
YYAYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYIN
RRI
Download sequence
Identical sequences P03870
R0010W 4932.R0010W gi|11466068|ref|NP_040488.1|NC_001398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]