SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for R0010W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0010W
Domain Number 1 Region: 136-422
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 7.53e-121
Family Lambda integrase-like, catalytic core 3.81e-11
Further Details:      
 
Domain Number 2 Region: 2-129
Classification Level Classification E-value
Superfamily lambda integrase-like, N-terminal domain 2.35e-83
Family lambda integrase-like, N-terminal domain 2.13e-07
Further Details:      
 

Protein sequence

External link(s) Locus: R0010W   Protein: S000029654
Sequence length 423
Comment FLP1 SGDID:S000029654, 2-micron plasmid from 252-1523, Verified ORF, "Site-specific recombinase encoded on the 2-micron plasmid, required for 2-micron plasmid propagation as part of a plasmid amplification system that compensates for any copy number decreases caused by missegregation events"
Sequence
MPQFGILCKTPPKVLVRQFVERFERPSGEKIALCAAELTYLCWMITHNGTAIKRATFMSY
NTIISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWEFTIIPYYGQKHQSDITDIV
SSLQLQFESSEEADKGNSHSKKMLKALLSEGESIWEITEKILNSFEYTSRFTKTKTLYQF
LFLATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTETKTSVSRHIYFFSARGRID
PLVYLDEFLRNSEPVLKRVNRTGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKN
GPKSHIGRHLMTSFLSMKGLTELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSR
YYAYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYIN
RRI
Download sequence
Identical sequences P03870
R0010W 4932.R0010W gi|11466068|ref|NP_040488.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]