SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for R0010W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0010W
Domain Number 1 Region: 136-422
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 7.53e-121
Family Lambda integrase-like, catalytic core 0.0000000000381
Further Details:      
 
Domain Number 2 Region: 2-129
Classification Level Classification E-value
Superfamily lambda integrase-like, N-terminal domain 2.35e-83
Family lambda integrase-like, N-terminal domain 0.000000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
cell division 1.424 25.7
chromatin remodeling 2.047 11.92
circadian rhythm 1.901 10.18
rhythmic process 1.667 8.26
multi-organism cellular process 1.714 7.85
chromatin organization 1.561 7.04
DNA conformation change 1.678 4.56
interspecies interaction between organisms 1.581 4.37
Cellular Component IC (bits) H-Score
cell body 1.498 12.74
chromosomal part 1.477 6.23

Protein sequence

External link(s) Locus: R0010W   Protein: S000029654
Sequence length 423
Comment FLP1 SGDID:S000029654, 2-micron plasmid from 252-1523, Verified ORF, "Site-specific recombinase encoded on the 2-micron plasmid, required for 2-micron plasmid propagation as part of a plasmid amplification system that compensates for any copy number decreases caused by missegregation events"
Sequence
MPQFGILCKTPPKVLVRQFVERFERPSGEKIALCAAELTYLCWMITHNGTAIKRATFMSY
NTIISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWEFTIIPYYGQKHQSDITDIV
SSLQLQFESSEEADKGNSHSKKMLKALLSEGESIWEITEKILNSFEYTSRFTKTKTLYQF
LFLATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTETKTSVSRHIYFFSARGRID
PLVYLDEFLRNSEPVLKRVNRTGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKN
GPKSHIGRHLMTSFLSMKGLTELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSR
YYAYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYIN
RRI
Download sequence
Identical sequences P03870
gi|11466068|ref|NP_040488.1|NC_001398 R0010W 4932.R0010W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]