SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for R0020C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: R0020C   Protein: S000029675
Sequence length 373
Comment REP1 SGDID:S000029675, 2-micron plasmid from 3008-1887, reverse complement, Verified ORF, "Master regulator that acts in concert with Rep2p to regulate transcript levels of the FLP1 gene that promotes plasmid copy amplification; autoregulates levels of its own transcript"
Sequence
MNGERLLACIKQCIMQHFQPMVYDESRCVIETTRGTFPVPDNYKKYKTLAFAFVGHVLNT
DDTPVIEKELDWPDPALVYNTIVDRIINHPELSQFISVAFISQLKATIGEGLDINVKGTL
NRRGKGIRRPKGVFFRYMESPFVNTKVTAFFSYLRDYNKIASEYHNNTKFILTFSCQAYW
ASGPNFSALKNVIRCSIIHEYISKFVEREQDKGHIGDQELPPEEDPSRELNNVQHEVNSL
TEQDAEADEGLWGEIDSLCEKWQSEAEDQTEAEIIADRIIGNSQRMANLKIRRTKFKSVL
YHILKELIQSQGTVKVYRGSSFSHDSIKISLHYEEQHITAVWVYLTVKFEEHWKPVDVEV
EFRCKFKERKVDG
Download sequence
Identical sequences E7KWB6 P03871
R0020C 4932.R0020C gi|11466069|ref|NP_040489.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]