SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for R0020C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: R0020C   Protein: S000029675
Sequence length 373
Comment REP1 SGDID:S000029675, 2-micron plasmid from 3008-1887, reverse complement, Verified ORF, "Master regulator that acts in concert with Rep2p to regulate transcript levels of the FLP1 gene that promotes plasmid copy amplification; autoregulates levels of its own transcript"
Sequence
MNGERLLACIKQCIMQHFQPMVYDESRCVIETTRGTFPVPDNYKKYKTLAFAFVGHVLNT
DDTPVIEKELDWPDPALVYNTIVDRIINHPELSQFISVAFISQLKATIGEGLDINVKGTL
NRRGKGIRRPKGVFFRYMESPFVNTKVTAFFSYLRDYNKIASEYHNNTKFILTFSCQAYW
ASGPNFSALKNVIRCSIIHEYISKFVEREQDKGHIGDQELPPEEDPSRELNNVQHEVNSL
TEQDAEADEGLWGEIDSLCEKWQSEAEDQTEAEIIADRIIGNSQRMANLKIRRTKFKSVL
YHILKELIQSQGTVKVYRGSSFSHDSIKISLHYEEQHITAVWVYLTVKFEEHWKPVDVEV
EFRCKFKERKVDG
Download sequence
Identical sequences E7KWB6 P03871
gi|11466069|ref|NP_040489.1|NC_001398 4932.R0020C R0020C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]