SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for R0030W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: R0030W   Protein: S000029674
Sequence length 181
Comment RAF1 SGDID:S000029674, 2-micron plasmid from 3271-3816, Verified ORF, "Anti-repressor that increases 2 micron plasmid copy number by relieving repression of the FLP1 site-specific recombinase caused by the Rep1-Rep2p trascription regulator; also itself repressed by the Rep1p-Rep2p complex"
Sequence
MPYKTAIDCIEELATQCFLSKLTDDDVSTFRRVCSKENDIIKLALRIPRTIDYTSILRLL
YDTLPLRSLSFNEALPLFCYSIDPAQQRQCDLRFYLRDVVKLARPRKRLEMQKALLQWLP
SLLSDVTLQLLNDIRIRFEEIQPNIRQTVLQIYDRTCYPSLNFEHPNLGVFPETDSIFEP
V
Download sequence
Identical sequences E7KWB7 H1PIJ2 I9KX15 Q06891
R0030W 4932.R0030W gi|11466070|ref|NP_040490.1|NC_001398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]