SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for R0030W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: R0030W   Protein: S000029674
Sequence length 181
Comment RAF1 SGDID:S000029674, 2-micron plasmid from 3271-3816, Verified ORF, "Anti-repressor that increases 2 micron plasmid copy number by relieving repression of the FLP1 site-specific recombinase caused by the Rep1-Rep2p trascription regulator; also itself repressed by the Rep1p-Rep2p complex"
Sequence
MPYKTAIDCIEELATQCFLSKLTDDDVSTFRRVCSKENDIIKLALRIPRTIDYTSILRLL
YDTLPLRSLSFNEALPLFCYSIDPAQQRQCDLRFYLRDVVKLARPRKRLEMQKALLQWLP
SLLSDVTLQLLNDIRIRFEEIQPNIRQTVLQIYDRTCYPSLNFEHPNLGVFPETDSIFEP
V
Download sequence
Identical sequences E7KWB7 H1PIJ2 I9KX15 Q06891
R0030W 4932.R0030W gi|11466070|ref|NP_040490.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]