SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for R0040C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: R0040C   Protein: S000029676
Sequence length 296
Comment REP2 SGDID:S000029676, 2-micron plasmid from 6198-5308, reverse complement, Verified ORF, "Master regulator that acts in concert with Rep1p to regulate transcript levels of the FLP1 gene that promotes plasmid copy amplification; also autoregulates levels of its own transcript"
Sequence
MDDIETAKNLTVKARTAYSVWDVCRLFIEMIAPDVDIDIESKRKSDELLFPGYVIRPMES
LTTGRPYGLDSSAEDSSVSSDSSAEVILPAAKMVKERFDSIGNGMLSSQEASQAAIDLML
QNNKLLDNRKQLYKSIAIIIGRLPEKDKKRATEMLMRKMDCTQLLVPPAPTEEDVMKLVS
VVTQLLTLVPPDRQAALIGDLFIPESLKDIFNSFNELAAENRLQQKKSELEGRTEVNHAN
TNEEVPSRRTRSRDTNARGAYKLQNTITEGPKAVPTKKRRVATRVRGRKSRNTSRV
Download sequence
Identical sequences C7GUP6 E7KWB8 P03872 U3X1G0 U4AU53 U4BJK5
R0040C 4932.R0040C gi|11466071|ref|NP_040491.1|

Jump to [ Top of page · Domain architecture · Domain assignment details ]