SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for R0040C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: R0040C   Protein: S000029676
Sequence length 296
Comment REP2 SGDID:S000029676, 2-micron plasmid from 6198-5308, reverse complement, Verified ORF, "Master regulator that acts in concert with Rep1p to regulate transcript levels of the FLP1 gene that promotes plasmid copy amplification; also autoregulates levels of its own transcript"
Sequence
MDDIETAKNLTVKARTAYSVWDVCRLFIEMIAPDVDIDIESKRKSDELLFPGYVIRPMES
LTTGRPYGLDSSAEDSSVSSDSSAEVILPAAKMVKERFDSIGNGMLSSQEASQAAIDLML
QNNKLLDNRKQLYKSIAIIIGRLPEKDKKRATEMLMRKMDCTQLLVPPAPTEEDVMKLVS
VVTQLLTLVPPDRQAALIGDLFIPESLKDIFNSFNELAAENRLQQKKSELEGRTEVNHAN
TNEEVPSRRTRSRDTNARGAYKLQNTITEGPKAVPTKKRRVATRVRGRKSRNTSRV
Download sequence
Identical sequences C7GUP6 E7KWB8 P03872 U3X1G0 U4AU53 U4BJK5
4932.R0040C R0040C gi|11466071|ref|NP_040491.1|NC_001398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]