SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YAL002W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL002W
Domain Number 1 Region: 57-227,291-359
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000288
Family WD40-repeat 0.045
Further Details:      
 
Domain Number 2 Region: 1181-1270
Classification Level Classification E-value
Superfamily RING/U-box 0.0000238
Family RING finger domain, C3HC4 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 42.51
nucleolus 1.652 36.88
methyltransferase complex 2.218 18.65
cilium 1.611 16.73
integral to plasma membrane 1.469 14.08
receptor complex 1.511 14.08
vacuole 1.428 11.94
microbody 1.956 11.94
nucleoplasm part 1.418 11.42
transcription factor complex 1.882 11.42

Protein sequence

External link(s) Locus: YAL002W   Protein: S000000002
Sequence length 1274
Comment VPS8 SGDID:S000000002, Chr I from 143709-147533, Verified ORF, "Membrane-associated protein that interacts with Vps21p to facilitate soluble vacuolar protein localization; component of the CORVET complex; required for localization and trafficking of the CPY sorting receptor; contains RING finger motif"
Sequence
MEQNGLDHDSRSSIDTTINDTQKTFLEFRSYTQLSEKLASSSSYTAPPLNEDGPKGVASA
VSQGSESVVSWTTLTHVYSILGAYGGPTCLYPTATYFLMGTSKGCVLIFNYNEHLQTILV
PTLSEDPSIHSIRSPVKSIVICSDGTHVAASYETGNICIWNLNVGYRVKPTSEPTNGMTP
TPALPAVLHIDDHVNKEITGLDFFGARHTALIVSDRTGKVSLYNGYRRGFWQLVYNSKKI
LDVNSSKEKLIRSKLSPLISREKISTNLLSVLTTTHFALILLSPHVSLMFQETVEPSVQN
SLVVNSSISWTQNCSRVAYSVNNKISVISISSSDFNVQSASHSPEFAESILSIQWIDQLL
LGVLTISHQFLVLHPQHDFKILLRLDFLIHDLMIPPNKYFVISRRSFYLLTNYSFKIGKF
VSWSDITLRHILKGDYLGALEFIESLLQPYCPLANLLKLDNNTEERTKQLMEPFYNLSLA
ALRFLIKKDNADYNRVYQLLMVVVRVLQQSSKKLDSIPSLDVFLEQGLEFFELKDNAVYF
EVVANIVAQGSVTSISPVLFRSIIDYYAKEENLKVIEDLIIMLNPTTLDVDLAVKLCQKY
NLFDLLIYIWNKIFDDYQTPVVDLIYRISNQSEKCVIFNGPQVPPETTIFDYVTYILTGR
QYPQNLSISPSDKCSKIQRELSAFIFSGFSIKWPSNSNHKLYICENPEEEPAFPYFHLLL
KSNPSRFLAMLNEVFEASLFNDDNDMVASVGEAELVSRQYVIDLLLDAMKDTGNSDNIRV
LVAIFIATSISKYPQFIKVSNQALDCVVNTICSSRVQGIYEISQIALESLLPYYHSRTTE
NFILELKEKNFNKVLFHIYKSENKYASALSLILETKDIEKEYNTDIVSITDYILKKCPPG
SLECGKVTEVIETNFDLLLSRIGIEKCVTIFSDFDYNLHQEILEVKNEETQQKYLDKLFS
TPNINNKVDKRLRNLHIELNCKYKSKREMILWLNGTVLSNAESLQILDLLNQDSNFEAAA
IIHERLESFNLAVRDLLSFIEQCLNEGKTNISTLLESLRRAFDDCNSAGTEKKSCWILLI
TFLITLYGKYPSHDERKDLCNKLLQEAFLGLVRSKSSSQKDSGGEFWEIMSSVLEHQDVI
LMKVQDLKQLLLNVFNTYKLERSLSELIQKIIEDSSQDLVQQYRKFLSEGWSIHTDDCEI
CGKKIWGAGLDPLLFLAWENVQRHQDMISVDLKTPLVIFKCHHGFHQTCLENLAQKPDEY
SCLICQTESNPKIV
Download sequence
Identical sequences N1PAZ4 P39702
4932.YAL002W YAL002W YAL002W YAL002W YAL002W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]