SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL002W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL002W
Domain Number 1 Region: 57-227,291-359
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.88e-12
Family WD40-repeat 0.045
Further Details:      
 
Domain Number 2 Region: 1181-1270
Classification Level Classification E-value
Superfamily RING/U-box 2.38e-05
Family RING finger domain, C3HC4 0.035
Further Details:      
 

Protein sequence

External link(s) Locus: YAL002W   Protein: S000000002
Sequence length 1274
Comment VPS8 SGDID:S000000002, Chr I from 143709-147533, Verified ORF, "Membrane-associated protein that interacts with Vps21p to facilitate soluble vacuolar protein localization; component of the CORVET complex; required for localization and trafficking of the CPY sorting receptor; contains RING finger motif"
Sequence
MEQNGLDHDSRSSIDTTINDTQKTFLEFRSYTQLSEKLASSSSYTAPPLNEDGPKGVASA
VSQGSESVVSWTTLTHVYSILGAYGGPTCLYPTATYFLMGTSKGCVLIFNYNEHLQTILV
PTLSEDPSIHSIRSPVKSIVICSDGTHVAASYETGNICIWNLNVGYRVKPTSEPTNGMTP
TPALPAVLHIDDHVNKEITGLDFFGARHTALIVSDRTGKVSLYNGYRRGFWQLVYNSKKI
LDVNSSKEKLIRSKLSPLISREKISTNLLSVLTTTHFALILLSPHVSLMFQETVEPSVQN
SLVVNSSISWTQNCSRVAYSVNNKISVISISSSDFNVQSASHSPEFAESILSIQWIDQLL
LGVLTISHQFLVLHPQHDFKILLRLDFLIHDLMIPPNKYFVISRRSFYLLTNYSFKIGKF
VSWSDITLRHILKGDYLGALEFIESLLQPYCPLANLLKLDNNTEERTKQLMEPFYNLSLA
ALRFLIKKDNADYNRVYQLLMVVVRVLQQSSKKLDSIPSLDVFLEQGLEFFELKDNAVYF
EVVANIVAQGSVTSISPVLFRSIIDYYAKEENLKVIEDLIIMLNPTTLDVDLAVKLCQKY
NLFDLLIYIWNKIFDDYQTPVVDLIYRISNQSEKCVIFNGPQVPPETTIFDYVTYILTGR
QYPQNLSISPSDKCSKIQRELSAFIFSGFSIKWPSNSNHKLYICENPEEEPAFPYFHLLL
KSNPSRFLAMLNEVFEASLFNDDNDMVASVGEAELVSRQYVIDLLLDAMKDTGNSDNIRV
LVAIFIATSISKYPQFIKVSNQALDCVVNTICSSRVQGIYEISQIALESLLPYYHSRTTE
NFILELKEKNFNKVLFHIYKSENKYASALSLILETKDIEKEYNTDIVSITDYILKKCPPG
SLECGKVTEVIETNFDLLLSRIGIEKCVTIFSDFDYNLHQEILEVKNEETQQKYLDKLFS
TPNINNKVDKRLRNLHIELNCKYKSKREMILWLNGTVLSNAESLQILDLLNQDSNFEAAA
IIHERLESFNLAVRDLLSFIEQCLNEGKTNISTLLESLRRAFDDCNSAGTEKKSCWILLI
TFLITLYGKYPSHDERKDLCNKLLQEAFLGLVRSKSSSQKDSGGEFWEIMSSVLEHQDVI
LMKVQDLKQLLLNVFNTYKLERSLSELIQKIIEDSSQDLVQQYRKFLSEGWSIHTDDCEI
CGKKIWGAGLDPLLFLAWENVQRHQDMISVDLKTPLVIFKCHHGFHQTCLENLAQKPDEY
SCLICQTESNPKIV
Download sequence
Identical sequences N1PAZ4 P39702
YAL002W YAL002W 4932.YAL002W YAL002W YAL002W

Jump to [ Top of page · Domain architecture · Domain assignment details ]