SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL012W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL012W
Domain Number 1 Region: 8-391
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.02e-103
Family Cystathionine synthase-like 1.59e-12
Further Details:      
 

Protein sequence

External link(s) Locus: YAL012W   Protein: S000000010
Sequence length 394
Comment CYS3 SGDID:S000000010, Chr I from 130802-131986, Verified ORF, "Cystathionine gamma-lyase, catalyzes one of the two reactions involved in the transsulfuration pathway that yields cysteine from homocysteine with the intermediary formation of cystathionine"
Sequence
MTLQESDKFATKAIHAGEHVDVHGSVIEPISLSTTFKQSSPANPIGTYEYSRSQNPNREN
LERAVAALENAQYGLAFSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAHGV
ETSFTNDLLNDLPQLIKENTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVILVVDN
TFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKPLYERLQFLQNAIGAIPS
PFDAWLTHRGLKTLHLRVRQAALSANKIAEFLAADKENVVAVNYPGLKTHPNYDVVLKQH
RDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEARE
ASGVFDDLVRISVGIEDTDDLLEDIKQALKQATN
Download sequence
Identical sequences A7A0F7 B3LUU9 B5VDL1 C7GPM2 C8Z3L8 E7K954 E7KJX5 E7NEI7 E7QB42 G2W8M0 H0GBX9 P31373
YAL012W YAL012W YAL012W YAL012W YAL012W YAL012W YAL012W 4932.YAL012W YAL012W SCRT_05646 YAL012W YAL012W tr|A7A0F7|A7A0F7_YEAS7 YAL012W YAL012W YAL012W YAL012W YAL012W

Jump to [ Top of page · Domain architecture · Domain assignment details ]