SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL012W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL012W
Domain Number 1 Region: 8-391
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.02e-103
Family Cystathionine synthase-like 1.59e-12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nuclear outer membrane-endoplasmic reticulum membrane network 1.559 41.9
endoplasmic reticulum part 1.433 41.9
mitochondrial matrix 1.707 9.9
mitochondrial envelope 1.571 5.13
mitochondrial inner membrane 1.752 5.13
organelle inner membrane 1.673 4.91
microbody 1.956 4.39
plastid 1.598 3.87

Protein sequence

External link(s) Locus: YAL012W   Protein: S000000010
Sequence length 394
Comment CYS3 SGDID:S000000010, Chr I from 130802-131986, Verified ORF, "Cystathionine gamma-lyase, catalyzes one of the two reactions involved in the transsulfuration pathway that yields cysteine from homocysteine with the intermediary formation of cystathionine"
Sequence
MTLQESDKFATKAIHAGEHVDVHGSVIEPISLSTTFKQSSPANPIGTYEYSRSQNPNREN
LERAVAALENAQYGLAFSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAHGV
ETSFTNDLLNDLPQLIKENTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVILVVDN
TFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKPLYERLQFLQNAIGAIPS
PFDAWLTHRGLKTLHLRVRQAALSANKIAEFLAADKENVVAVNYPGLKTHPNYDVVLKQH
RDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEARE
ASGVFDDLVRISVGIEDTDDLLEDIKQALKQATN
Download sequence
Identical sequences A7A0F7 B3LUU9 B5VDL1 C7GPM2 C8Z3L8 E7K954 E7KJX5 E7NEI7 E7QB42 G2W8M0 H0GBX9 N1P9T9 P31373 W7Q049 W7RF00
YAL012W YAL012W YAL012W YAL012W YAL012W YAL012W YAL012W 4932.YAL012W YAL012W SCRT_05646 YAL012W YAL012W tr|A7A0F7|A7A0F7_YEAS7 YAL012W YAL012W YAL012W YAL012W YAL012W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]