SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL016C-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YAL016C-B   Protein: S000028528
Sequence length 61
Comment YAL016C-B SGDID:S000028528, Chr I from 124493-124308, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MLYFYHINILIKERKYILIYSYLNRENYQLITEESKKNDIPSIVSTGYFFAFSFPITNVL
E
Download sequence
Identical sequences B3LUV1 P0C1V3 W7Q044
YAL016C-B YAL016C-B YAL016C-B YAL016C-B YAL016C-B YAL016C-B YAL016C-B YAL016C-B YAL016C-B YAL016C-B YAL016C-B 4932.YAL016C-B YAL016C-B SCRT_05651 YAL016C-B YAL016C-B YAL016C-B

Jump to [ Top of page · Domain architecture · Domain assignment details ]