SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YAL016C-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YAL016C-B   Protein: S000028528
Sequence length 61
Comment YAL016C-B SGDID:S000028528, Chr I from 124493-124308, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MLYFYHINILIKERKYILIYSYLNRENYQLITEESKKNDIPSIVSTGYFFAFSFPITNVL
E
Download sequence
Identical sequences B3LUV1 P0C1V3
YAL016C-B YAL016C-B 4932.YAL016C-B YAL016C-B YAL016C-B YAL016C-B YAL016C-B YAL016C-B YAL016C-B SCRT_05651 YAL016C-B YAL016C-B YAL016C-B YAL016C-B YAL016C-B YAL016C-B YAL016C-B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]