SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL031W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YAL031W-A   Protein: S000028731
Sequence length 102
Comment YAL031W-A SGDID:S000028731, Chr I from 84670-84978, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MKDMNSIRYVFFFFSRDIKSCFYKVRSYLNLLLILEAILCPVDSLISIPNGIMVVSEPDS
PFSHSNPSRRLFRKVNPSSCLSVLYLDLCCSGLIIAEAGIGG
Download sequence
Identical sequences C8Z3H0
YAL031W-A YAL031W-A 4932.YAL031W-A YAL031W-A YAL031W-A YAL031W-A YAL031W-A YAL031W-A YAL031W-A YAL031W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]