SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YAL037C-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YAL037C-B   Protein: S000028592
Sequence length 324
Comment YAL037C-B SGDID:S000028592, Chr I from 73301-72327, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MILFLNGRDLQSVGVTSTGLETLDGNVSVTLLQDTEFLSLFNTEVDTGFNIISPVRDRFL
FENEWEDTSVQVRESSSSWASGNQDDWTVWSVLGNQSWGGTGSGQDNDSLGLLFENSSDS
GGSDGFGGGGWLWSTVSHVIVVWQVSDSLFSNDSGFSHSGNGVDWVVTLGGFTRQHNTVS
TIQDSVTDIGNFSSGWSWVVSHGFQHLGSTDNWLTSQVRLSNQFLLDSQDFWGWDFNTQV
TSGNHNTVSDLQDFVEVVNTLLVFNLDNDLDVLTLFTQDFSDGQNIVGGSDERSEDHVDT
VLDTESQIFLVLFRQSWQIDIGTW
Download sequence
Identical sequences B5VDI1 C8Z3F2 Q8TGR8 W7PY82
4932.YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]