SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL037C-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YAL037C-B   Protein: S000028592
Sequence length 324
Comment YAL037C-B SGDID:S000028592, Chr I from 73301-72327, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MILFLNGRDLQSVGVTSTGLETLDGNVSVTLLQDTEFLSLFNTEVDTGFNIISPVRDRFL
FENEWEDTSVQVRESSSSWASGNQDDWTVWSVLGNQSWGGTGSGQDNDSLGLLFENSSDS
GGSDGFGGGGWLWSTVSHVIVVWQVSDSLFSNDSGFSHSGNGVDWVVTLGGFTRQHNTVS
TIQDSVTDIGNFSSGWSWVVSHGFQHLGSTDNWLTSQVRLSNQFLLDSQDFWGWDFNTQV
TSGNHNTVSDLQDFVEVVNTLLVFNLDNDLDVLTLFTQDFSDGQNIVGGSDERSEDHVDT
VLDTESQIFLVLFRQSWQIDIGTW
Download sequence
Identical sequences B5VDI1 C8Z3F2 Q8TGR8
YAL037C-B 4932.YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B YAL037C-B

Jump to [ Top of page · Domain architecture · Domain assignment details ]