SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL038W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL038W
Domain Number 1 Region: 16-92,177-361
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 2.79e-99
Family Pyruvate kinase 0.00000000474
Further Details:      
 
Domain Number 2 Region: 369-500
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 2.09e-42
Family Pyruvate kinase, C-terminal domain 0.00000025
Further Details:      
 
Domain Number 3 Region: 88-188
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 1.26e-26
Family Pyruvate kinase beta-barrel domain 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
chloroplast part 1.896 6.75
plastid stroma 2.025 6.64
plastid 1.6 5.19
cytosol 1.301 3.57
Molecular Function IC (bits) H-Score
carboxy-lyase activity 2.068 100.37
transferase activity, transferring one-carbon groups 1.593 86.92
lyase activity 1.474 26.41
magnesium ion binding 2.013 4.61

Protein sequence

External link(s) Locus: YAL038W   Protein: S000000036
Sequence length 500
Comment CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration"
Sequence
MSRLERLTSLNVVAGSDLRRTSIIGTIGPKTNNPETLVALRKAGLNIVRMNFSHGSYEYH
KSVIDNARKSEELYPGRPLAIALDTKGPEIRTGTTTNDVDYPIPPNHEMIFTTDDKYAKA
CDDKIMYVDYKNITKVISAGRIIYVDDGVLSFQVLEVVDDKTLKVKALNAGKICSHKGVN
LPGTDVDLPALSEKDKEDLRFGVKNGVHMVFASFIRTANDVLTIREVLGEQGKDVKIIVK
IENQQGVNNFDEILKVTDGVMVARGDLGIEIPAPEVLAVQKKLIAKSNLAGKPVICATQM
LESMTYNPRPTRAEVSDVGNAILDGADCVMLSGETAKGNYPINAVTTMAETAVIAEQAIA
YLPNYDDMRNCTPKPTSTTETVAASAVAAVFEQKAKAIIVLSTSGTTPRLVSKYRPNCPI
ILVTRCPRAARFSHLYRGVFPFVFEKEPVSDWTDDVEARINFGIEKAKEFGILKKGDTYV
SIQGFKAGAGHSNTLQVSTV
Download sequence
Identical sequences A7A0C8 B3LUX4 B5VDI0 C7GU44 C8Z3F1 E7K937 E7LQZ2 E7Q0J0 E7QB26 G2W8J2 H0GBV9 N1P8V5 P00549 U5TV04 W7PQP3 W7RNA0
4932.YAL038W YAL038W YAL038W YAL038W YAL038W YAL038W YAL038W YAL038W YAL038W YAL038W YAL038W YAL038W 1a3xA YAL038W YAL038W YAL038W YAL038W YAL038W YAL038W YAL038W YAL038W tr|A7A0C8|A7A0C8_YEAS7 1a3w.A 1a3w.B 1a3x.A 1a3x.B SCRT_05675 YAL038W YAL038W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]