SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL038W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL038W
Domain Number 1 Region: 16-92,177-361
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 2.79e-99
Family Pyruvate kinase 4.74e-09
Further Details:      
 
Domain Number 2 Region: 369-500
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 2.09e-42
Family Pyruvate kinase, C-terminal domain 2.5e-07
Further Details:      
 
Domain Number 3 Region: 88-188
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 1.26e-26
Family Pyruvate kinase beta-barrel domain 1.04e-06
Further Details:      
 

Protein sequence

External link(s) Locus: YAL038W   Protein: S000000036
Sequence length 500
Comment CDC19 SGDID:S000000036, Chr I from 71787-73289, Verified ORF, "Pyruvate kinase, functions as a homotetramer in glycolysis to convert phosphoenolpyruvate to pyruvate, the input for aerobic (TCA cycle) or anaerobic (glucose fermentation) respiration"
Sequence
MSRLERLTSLNVVAGSDLRRTSIIGTIGPKTNNPETLVALRKAGLNIVRMNFSHGSYEYH
KSVIDNARKSEELYPGRPLAIALDTKGPEIRTGTTTNDVDYPIPPNHEMIFTTDDKYAKA
CDDKIMYVDYKNITKVISAGRIIYVDDGVLSFQVLEVVDDKTLKVKALNAGKICSHKGVN
LPGTDVDLPALSEKDKEDLRFGVKNGVHMVFASFIRTANDVLTIREVLGEQGKDVKIIVK
IENQQGVNNFDEILKVTDGVMVARGDLGIEIPAPEVLAVQKKLIAKSNLAGKPVICATQM
LESMTYNPRPTRAEVSDVGNAILDGADCVMLSGETAKGNYPINAVTTMAETAVIAEQAIA
YLPNYDDMRNCTPKPTSTTETVAASAVAAVFEQKAKAIIVLSTSGTTPRLVSKYRPNCPI
ILVTRCPRAARFSHLYRGVFPFVFEKEPVSDWTDDVEARINFGIEKAKEFGILKKGDTYV
SIQGFKAGAGHSNTLQVSTV
Download sequence
Identical sequences A7A0C8 B3LUX4 B5VDI0 C7GU44 C8Z3F1 E7K937 E7LQZ2 E7Q0J0 E7QB26 G2W8J2 H0GBV9 P00549
YAL038W 1a3xA YAL038W YAL038W YAL038W YAL038W YAL038W YAL038W YAL038W YAL038W YAL038W 4932.YAL038W YAL038W SCRT_05675 YAL038W YAL038W YAL038W tr|A7A0C8|A7A0C8_YEAS7 1a3w.A 1a3w.B 1a3x.A 1a3x.B YAL038W YAL038W YAL038W YAL038W YAL038W YAL038W YAL038W

Jump to [ Top of page · Domain architecture · Domain assignment details ]