SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL047W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YAL047W-A   Protein: S000028733
Sequence length 109
Comment YAL047W-A SGDID:S000028733, Chr I from 54585-54914, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MRSESEVSISTVFLGEYVGDDEKSLGILMGGSTSCMVGMNSAFVNDTIRLDLPTPSSPQI
TTRIVSLVIVLFNTLVFRSPLFLFSIFICLIYKFHSCFEGKPLYQMLKI
Download sequence
Identical sequences C8Z3G4
YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A 4932.YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]