SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL047W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YAL047W-A   Protein: S000028733
Sequence length 109
Comment YAL047W-A SGDID:S000028733, Chr I from 54585-54914, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MRSESEVSISTVFLGEYVGDDEKSLGILMGGSTSCMVGMNSAFVNDTIRLDLPTPSSPQI
TTRIVSLVIVLFNTLVFRSPLFLFSIFICLIYKFHSCFEGKPLYQMLKI
Download sequence
Identical sequences C8Z3G4 W7PQN8
YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A 4932.YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A YAL047W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]