SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL054C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL054C
Domain Number 1 Region: 75-708
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 6.02e-175
Family Acetyl-CoA synthetase-like 2.8e-17
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microbody 1.956 17.61
basolateral plasma membrane 1.917 6.97
intrinsic to organelle membrane 2.091 5.87
basal part of cell 2.168 5.15
lipid particle 1.526 4.28
Biological Process IC (bits) H-Score
fatty acid metabolic process 1.622 47.4
coenzyme biosynthetic process 1.925 38.78
response to cytokine stimulus 1.509 33.51
cytokine-mediated signaling pathway 1.951 33.51
thioester metabolic process 2.096 32.39
amide biosynthetic process 1.511 26.44
lipid transport 1.877 20.64
peptide metabolic process 1.567 18.15
pigmentation 2.04 16.92
cuticle development 2.008 16.92

Protein sequence

External link(s) Locus: YAL054C   Protein: S000000050
Sequence length 713
Comment ACS1 SGDID:S000000050, Chr I from 45023-42882, reverse complement, Verified ORF, "Acetyl-coA synthetase isoform which, along with Acs2p, is the nuclear source of acetyl-coA for histone acetlyation; expressed during growth on nonfermentable carbon sources and under aerobic conditions"
Sequence
MSPSAVQSSKLEEQSSEIDKLKAKMSQSAATAQQKKEHEYEHLTSVKIVPQRPISDRLQP
AIATHYSPHLDGLQDYQRLHKESIEDPAKFFGSKATQFLNWSKPFDKVFIPDPKTGRPSF
QNNAWFLNGQLNACYNCVDRHALKTPNKKAIIFEGDEPGQGYSITYKELLEEVCQVAQVL
TYSMGVRKGDTVAVYMPMVPEAIITLLAISRIGAIHSVVFAGFSSNSLRDRINDGDSKVV
ITTDESNRGGKVIETKRIVDDALRETPGVRHVLVYRKTNNPSVAFHAPRDLDWATEKKKY
KTYYPCTPVDSEDPLFLLYTSGSTGAPKGVQHSTAGYLLGALLTMRYTFDTHQEDVFFTA
GDIGWITGHTYVVYGPLLYGCATLVFEGTPAYPNYSRYWDIIDEHKVTQFYVAPTALRLL
KRAGDSYIENHSLKSLRCLGSVGEPIAAEVWEWYSEKIGKNEIPIVDTYWQTESGSHLVT
PLAGGVTPMKPGSASFPFFGIDAVVLDPNTGEELNTSHAEGVLAVKAAWPSFARTIWKNH
DRYLDTYLNPYPGYYFTGDGAAKDKDGYIWILGRVDDVVNVSGHRLSTAEIEAAIIEDPI
VAECAVVGFNDDLTGQAVAAFVVLKNKSSWSTATDDELQDIKKHLVFTVRKDIGPFAAPK
LIILVDDLPKTRSGKIMRRILRKILAGESDQLGDVSTLSNPGIVRHLIDSVKL
Download sequence
Identical sequences Q01574
YAL054C YAL054C 4932.YAL054C YAL054C YAL054C YAL054C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]