SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL054C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL054C
Domain Number 1 Region: 75-708
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 6.02e-175
Family Acetyl-CoA synthetase-like 2.8e-17
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microbody 1.95 17.61
basolateral plasma membrane 1.896 6.93
intrinsic component of organelle membrane 2.09 5.35
basal part of cell 2.168 5.09
lipid particle 1.469 4.77

Protein sequence

External link(s) Locus: YAL054C   Protein: S000000050
Sequence length 713
Comment ACS1 SGDID:S000000050, Chr I from 45023-42882, reverse complement, Verified ORF, "Acetyl-coA synthetase isoform which, along with Acs2p, is the nuclear source of acetyl-coA for histone acetlyation; expressed during growth on nonfermentable carbon sources and under aerobic conditions"
Sequence
MSPSAVQSSKLEEQSSEIDKLKAKMSQSAATAQQKKEHEYEHLTSVKIVPQRPISDRLQP
AIATHYSPHLDGLQDYQRLHKESIEDPAKFFGSKATQFLNWSKPFDKVFIPDPKTGRPSF
QNNAWFLNGQLNACYNCVDRHALKTPNKKAIIFEGDEPGQGYSITYKELLEEVCQVAQVL
TYSMGVRKGDTVAVYMPMVPEAIITLLAISRIGAIHSVVFAGFSSNSLRDRINDGDSKVV
ITTDESNRGGKVIETKRIVDDALRETPGVRHVLVYRKTNNPSVAFHAPRDLDWATEKKKY
KTYYPCTPVDSEDPLFLLYTSGSTGAPKGVQHSTAGYLLGALLTMRYTFDTHQEDVFFTA
GDIGWITGHTYVVYGPLLYGCATLVFEGTPAYPNYSRYWDIIDEHKVTQFYVAPTALRLL
KRAGDSYIENHSLKSLRCLGSVGEPIAAEVWEWYSEKIGKNEIPIVDTYWQTESGSHLVT
PLAGGVTPMKPGSASFPFFGIDAVVLDPNTGEELNTSHAEGVLAVKAAWPSFARTIWKNH
DRYLDTYLNPYPGYYFTGDGAAKDKDGYIWILGRVDDVVNVSGHRLSTAEIEAAIIEDPI
VAECAVVGFNDDLTGQAVAAFVVLKNKSSWSTATDDELQDIKKHLVFTVRKDIGPFAAPK
LIILVDDLPKTRSGKIMRRILRKILAGESDQLGDVSTLSNPGIVRHLIDSVKL
Download sequence
Identical sequences Q01574
YAL054C YAL054C YAL054C 4932.YAL054C YAL054C YAL054C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]