SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL059C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YAL059C-A   Protein: S000028734
Sequence length 140
Comment YAL059C-A SGDID:S000028734, Chr I from 36919-36497, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps verified gene ECM1/YAL059W"
Sequence
MYLAREMDLAILPSRRLVKFKAFTKRSLSMDEIELSSLSSRAFLFNFLPLLLLLAFLDIF
ASSNASFLAAVLIKILVKSVFSALGSSLKSFTSGSRASDCLAALEFFDIFLAMLCFRRYL
TSIVKEKTTFCRLCSHIQYF
Download sequence
Identical sequences YAL059C-A 4932.YAL059C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]