SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL059C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YAL059C-A   Protein: S000028734
Sequence length 140
Comment YAL059C-A SGDID:S000028734, Chr I from 36919-36497, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps verified gene ECM1/YAL059W"
Sequence
MYLAREMDLAILPSRRLVKFKAFTKRSLSMDEIELSSLSSRAFLFNFLPLLLLLAFLDIF
ASSNASFLAAVLIKILVKSVFSALGSSLKSFTSGSRASDCLAALEFFDIFLAMLCFRRYL
TSIVKEKTTFCRLCSHIQYF
Download sequence
Identical sequences YAL059C-A 4932.YAL059C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]