SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL060W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL060W
Domain Number 1 Region: 1-199
Classification Level Classification E-value
Superfamily GroES-like 2.13e-43
Family Alcohol dehydrogenase-like, N-terminal domain 0.00066
Further Details:      
 
Domain Number 2 Region: 164-335
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.65e-34
Family Alcohol dehydrogenase-like, C-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral to plasma membrane 1.469 17.17
cilium 1.611 15.48
cilium part 1.917 15.48
microbody 1.956 12.44
synapse part 1.513 10.62
axon 1.511 10.62
cation channel complex 2.039 7.93
Golgi membrane 1.596 7.26
intrinsic to organelle membrane 2.091 7.26
neuron projection terminus 2.132 7.18

Protein sequence

External link(s) Locus: YAL060W   Protein: S000000056
Sequence length 382
Comment BDH1 SGDID:S000000056, Chr I from 35156-36304, Verified ORF, "NAD-dependent (R,R)-butanediol dehydrogenase, catalyzes oxidation of (R,R)-2,3-butanediol to (3R)-acetoin, oxidation of meso-butanediol to (3S)-acetoin, and reduction of acetoin; enhances use of 2,3-butanediol as an aerobic carbon source"
Sequence
MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGPIFMPKDGECH
KLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPC
DACQRGSENLCTHAGFVGLGVISGGFAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWH
AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNP
SKHGHKSIEILRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF
QPMDVTLQEKVMTGSIGYVVEAFEEVVRAIHNGDIAMEDCKQLITGKQRIEDGWEKGFQE
LMDHKESNVKILLTPNNHGEMK
Download sequence
Identical sequences YAL060W 4932.YAL060W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]