SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL060W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL060W
Domain Number 1 Region: 1-199
Classification Level Classification E-value
Superfamily GroES-like 2.13e-43
Family Alcohol dehydrogenase-like, N-terminal domain 0.00066
Further Details:      
 
Domain Number 2 Region: 164-335
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.65e-34
Family Alcohol dehydrogenase-like, C-terminal domain 0.0021
Further Details:      
 

Protein sequence

External link(s) Locus: YAL060W   Protein: S000000056
Sequence length 382
Comment BDH1 SGDID:S000000056, Chr I from 35156-36304, Verified ORF, "NAD-dependent (R,R)-butanediol dehydrogenase, catalyzes oxidation of (R,R)-2,3-butanediol to (3R)-acetoin, oxidation of meso-butanediol to (3S)-acetoin, and reduction of acetoin; enhances use of 2,3-butanediol as an aerobic carbon source"
Sequence
MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGPIFMPKDGECH
KLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPC
DACQRGSENLCTHAGFVGLGVISGGFAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWH
AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNP
SKHGHKSIEILRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF
QPMDVTLQEKVMTGSIGYVVEAFEEVVRAIHNGDIAMEDCKQLITGKQRIEDGWEKGFQE
LMDHKESNVKILLTPNNHGEMK
Download sequence
Identical sequences YAL060W 4932.YAL060W

Jump to [ Top of page · Domain architecture · Domain assignment details ]