SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YAL060W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL060W
Domain Number 1 Region: 1-199
Classification Level Classification E-value
Superfamily GroES-like 2.13e-43
Family Alcohol dehydrogenase-like, N-terminal domain 0.00066
Further Details:      
 
Domain Number 2 Region: 164-335
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.65e-34
Family Alcohol dehydrogenase-like, C-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
side of membrane 1.57 13.65
organelle inner membrane 1.692 13.65
mitochondrial envelope 1.593 13.65
microbody 1.816 10.11
oxidoreductase complex 1.774 7.67
Golgi membrane 1.579 7.13
intrinsic component of organelle membrane 2.148 7.13
cilium 1.637 7.05
lipid particle 1.395 6.78
cytosolic part 1.678 6.35

Protein sequence

External link(s) Locus: YAL060W   Protein: S000000056
Sequence length 382
Comment BDH1 SGDID:S000000056, Chr I from 35156-36304, Verified ORF, "NAD-dependent (R,R)-butanediol dehydrogenase, catalyzes oxidation of (R,R)-2,3-butanediol to (3R)-acetoin, oxidation of meso-butanediol to (3S)-acetoin, and reduction of acetoin; enhances use of 2,3-butanediol as an aerobic carbon source"
Sequence
MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGPIFMPKDGECH
KLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPC
DACQRGSENLCTHAGFVGLGVISGGFAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWH
AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNP
SKHGHKSIEILRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF
QPMDVTLQEKVMTGSIGYVVEAFEEVVRAIHNGDIAMEDCKQLITGKQRIEDGWEKGFQE
LMDHKESNVKILLTPNNHGEMK
Download sequence
Identical sequences 4932.YAL060W YAL060W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]