SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL061W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL061W
Domain Number 1 Region: 1-198
Classification Level Classification E-value
Superfamily GroES-like 3.64e-42
Family Alcohol dehydrogenase-like, N-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 165-337
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.09e-34
Family Alcohol dehydrogenase-like, C-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral component of plasma membrane 1.462 17.2
cilium 1.573 15.5
ciliary part 1.844 15.5
microbody 1.95 12.45
axon 1.505 9.57
synapse part 1.451 9.57
oxidoreductase complex 1.872 8.62
cation channel complex 2.046 7.93
Golgi membrane 1.613 7.27
intrinsic component of organelle membrane 2.09 7.27

Protein sequence

External link(s) Locus: YAL061W   Protein: S000000057
Sequence length 417
Comment BDH2 SGDID:S000000057, Chr I from 33449-34702, Uncharacterized ORF, "Putative medium-chain alcohol dehydrogenase with similarity to BDH1; transcription induced by constitutively active PDR1 and PDR3; BDH2 is an essential gene"
Sequence
MRALAYFGKGNIRFTNHLKEPHIVAPDELVIDIEWCGICGTDLHEYTDGPIFFPEDGHTH
EISHNPLPQAMGHEMAGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWC
AACKKGYYNICSYLGLCGAGVQSGGFAERVVMNESHCYKVPDFVPLDVAALIQPLAVCWH
AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPAKVRRELAEKMGARVYDP
TAHAAKESIDYLRSIADGGDGFDYTFDCSGLEVTLNAAIQCLTFRGTAVNLAMWGHHKIQ
FSPMDITLHERKYTGSMCYTHHDFEAVIEALEEGRIDIDRARHMITGRVNIEDGLDGAIM
KLINEKESTIKIILTPNNHGELNREADNEKKEISELSSRKDQERLRESINEAKLRHT
Download sequence
Identical sequences P39713
YAL061W YAL061W 4932.YAL061W YAL061W YAL061W YAL061W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]