SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL061W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL061W
Domain Number 1 Region: 1-198
Classification Level Classification E-value
Superfamily GroES-like 3.64e-42
Family Alcohol dehydrogenase-like, N-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 165-337
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.09e-34
Family Alcohol dehydrogenase-like, C-terminal domain 0.0035
Further Details:      
 

Protein sequence

External link(s) Locus: YAL061W   Protein: S000000057
Sequence length 417
Comment BDH2 SGDID:S000000057, Chr I from 33449-34702, Uncharacterized ORF, "Putative medium-chain alcohol dehydrogenase with similarity to BDH1; transcription induced by constitutively active PDR1 and PDR3; BDH2 is an essential gene"
Sequence
MRALAYFGKGNIRFTNHLKEPHIVAPDELVIDIEWCGICGTDLHEYTDGPIFFPEDGHTH
EISHNPLPQAMGHEMAGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWC
AACKKGYYNICSYLGLCGAGVQSGGFAERVVMNESHCYKVPDFVPLDVAALIQPLAVCWH
AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPAKVRRELAEKMGARVYDP
TAHAAKESIDYLRSIADGGDGFDYTFDCSGLEVTLNAAIQCLTFRGTAVNLAMWGHHKIQ
FSPMDITLHERKYTGSMCYTHHDFEAVIEALEEGRIDIDRARHMITGRVNIEDGLDGAIM
KLINEKESTIKIILTPNNHGELNREADNEKKEISELSSRKDQERLRESINEAKLRHT
Download sequence
Identical sequences P39713
YAL061W YAL061W 4932.YAL061W YAL061W YAL061W YAL061W

Jump to [ Top of page · Domain architecture · Domain assignment details ]