SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YAL067C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL067C
Domain Number 1 Region: 126-557
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.75e-54
Family Glycerol-3-phosphate transporter 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
carbohydrate transport 2.21 61.71
nucleobase-containing compound transport 2.03 39.18
ion transport 1.48 35.3
transmembrane transport 1.589 31.84
secretion 1.494 23.86
synaptic vesicle cycle 2.21 17.92
neurotransmitter transport 2.183 17.92
cation homeostasis 1.52 16.07
inorganic ion homeostasis 1.505 16.07
cellular chemical homeostasis 1.503 16.07
Cellular Component IC (bits) H-Score
cytoplasmic vesicle part 1.377 14.65
vacuolar part 1.526 14.09
cell projection membrane 1.808 11.21
clathrin-coated vesicle 1.946 10.05
presynapse 1.715 9.7
transport vesicle 1.738 9.64
secretory vesicle 1.491 8.6
exocytic vesicle 1.966 7.78
lytic vacuole 1.526 7.14
brush border 1.374 6.86

Protein sequence

External link(s) Locus: YAL067C   Protein: S000000062
Sequence length 593
Comment SEO1 SGDID:S000000062, Chr I from 9017-7236, reverse complement, Verified ORF, "Putative permease, member of the allantoate transporter subfamily of the major facilitator superfamily; mutation confers resistance to ethionine sulfoxide"
Sequence
MYSIVKEIIVDPYKRLKWGFIPVKRQVEDLPDDLNSTEIVTISNSIQSHETAENFITTTS
EKDQLHFETSSYSEHKDNVNVTRSYEYRDEADRPWWRFFDEQEYRINEKERSHNKWYSWF
KQGTSFKEKKLLIKLDVLLAFYSCIAYWVKYLDTVNINNAYVSGMKEDLGFQGNDLVHTQ
VMYTVGNIIFQLPFLIYLNKLPLNYVLPSLDLCWSLLTVGAAYVNSVPHLKAIRFFIGAF
EAPSYLAYQYLFGSFYKHDEMVRRSAFYYLGQYIGILSAGGIQSAVYSSLNGVNGLEGWR
WNFIIDAIVSVVVGLIGFYSLPGDPYNCYSIFLTDDEIRLARKRLKENQTGKSDFETKVF
DIKLWKTIFSDWKIYILTLWNIFCWNDSNVSSGAYLLWLKSLKRYSIPKLNQLSMITPGL
GMVYLMLTGIIADKLHSRWFAIIFTQVFNIIGNSILAAWDVAEGAKWFAFMLQCFGWAMA
PVLYSWQNDICRRDAQTRAITLVTMNIMAQSSTAWISVLVWKTEEAPRYLKGFTFTACSA
FCLSIWTFVVLYFYKRDERNNAKKNGIVLYNSKHGVEKPTSKDVETLSVSDEK
Download sequence
Identical sequences P39709
YAL067C YAL067C YAL067C 4932.YAL067C YAL067C YAL067C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]