SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YAL067C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL067C
Domain Number 1 Region: 126-557
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.75e-54
Family Glycerol-3-phosphate transporter 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
nucleobase-containing compound transport 2.039 39.45
ion transport 1.47 36.53
transmembrane transport 1.581 31.84
secretion 1.506 22.79
cellular chemical homeostasis 1.499 16.18
inorganic ion homeostasis 1.494 16.18
cation homeostasis 1.508 16.18
vacuole organization 2.183 16.18
response to organic cyclic compound 1.42 12.27
response to drug 1.512 12.02
Cellular Component IC (bits) H-Score
cytoplasmic vesicle part 1.417 14.48
vacuolar part 1.567 14.15
brush border membrane 1.487 11.03
clathrin-coated vesicle 1.989 10.1
presynapse 1.758 9.56
secretory vesicle 1.539 8.53
exocytic vesicle 2.03 7.81
lytic vacuole 1.553 7.12
intrinsic component of organelle membrane 2.016 6.26
synapse part 1.419 5.81

Protein sequence

External link(s) Locus: YAL067C   Protein: S000000062
Sequence length 593
Comment SEO1 SGDID:S000000062, Chr I from 9017-7236, reverse complement, Verified ORF, "Putative permease, member of the allantoate transporter subfamily of the major facilitator superfamily; mutation confers resistance to ethionine sulfoxide"
Sequence
MYSIVKEIIVDPYKRLKWGFIPVKRQVEDLPDDLNSTEIVTISNSIQSHETAENFITTTS
EKDQLHFETSSYSEHKDNVNVTRSYEYRDEADRPWWRFFDEQEYRINEKERSHNKWYSWF
KQGTSFKEKKLLIKLDVLLAFYSCIAYWVKYLDTVNINNAYVSGMKEDLGFQGNDLVHTQ
VMYTVGNIIFQLPFLIYLNKLPLNYVLPSLDLCWSLLTVGAAYVNSVPHLKAIRFFIGAF
EAPSYLAYQYLFGSFYKHDEMVRRSAFYYLGQYIGILSAGGIQSAVYSSLNGVNGLEGWR
WNFIIDAIVSVVVGLIGFYSLPGDPYNCYSIFLTDDEIRLARKRLKENQTGKSDFETKVF
DIKLWKTIFSDWKIYILTLWNIFCWNDSNVSSGAYLLWLKSLKRYSIPKLNQLSMITPGL
GMVYLMLTGIIADKLHSRWFAIIFTQVFNIIGNSILAAWDVAEGAKWFAFMLQCFGWAMA
PVLYSWQNDICRRDAQTRAITLVTMNIMAQSSTAWISVLVWKTEEAPRYLKGFTFTACSA
FCLSIWTFVVLYFYKRDERNNAKKNGIVLYNSKHGVEKPTSKDVETLSVSDEK
Download sequence
Identical sequences P39709
YAL067C YAL067C YAL067C YAL067C 4932.YAL067C YAL067C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]