SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL067C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL067C
Domain Number 1 Region: 126-557
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.75e-54
Family Glycerol-3-phosphate transporter 0.052
Further Details:      
 

Protein sequence

External link(s) Locus: YAL067C   Protein: S000000062
Sequence length 593
Comment SEO1 SGDID:S000000062, Chr I from 9017-7236, reverse complement, Verified ORF, "Putative permease, member of the allantoate transporter subfamily of the major facilitator superfamily; mutation confers resistance to ethionine sulfoxide"
Sequence
MYSIVKEIIVDPYKRLKWGFIPVKRQVEDLPDDLNSTEIVTISNSIQSHETAENFITTTS
EKDQLHFETSSYSEHKDNVNVTRSYEYRDEADRPWWRFFDEQEYRINEKERSHNKWYSWF
KQGTSFKEKKLLIKLDVLLAFYSCIAYWVKYLDTVNINNAYVSGMKEDLGFQGNDLVHTQ
VMYTVGNIIFQLPFLIYLNKLPLNYVLPSLDLCWSLLTVGAAYVNSVPHLKAIRFFIGAF
EAPSYLAYQYLFGSFYKHDEMVRRSAFYYLGQYIGILSAGGIQSAVYSSLNGVNGLEGWR
WNFIIDAIVSVVVGLIGFYSLPGDPYNCYSIFLTDDEIRLARKRLKENQTGKSDFETKVF
DIKLWKTIFSDWKIYILTLWNIFCWNDSNVSSGAYLLWLKSLKRYSIPKLNQLSMITPGL
GMVYLMLTGIIADKLHSRWFAIIFTQVFNIIGNSILAAWDVAEGAKWFAFMLQCFGWAMA
PVLYSWQNDICRRDAQTRAITLVTMNIMAQSSTAWISVLVWKTEEAPRYLKGFTFTACSA
FCLSIWTFVVLYFYKRDERNNAKKNGIVLYNSKHGVEKPTSKDVETLSVSDEK
Download sequence
Identical sequences P39709
YAL067C YAL067C 4932.YAL067C YAL067C YAL067C YAL067C

Jump to [ Top of page · Domain architecture · Domain assignment details ]