SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YAL067C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAL067C
Domain Number 1 Region: 126-557
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.75e-54
Family Glycerol-3-phosphate transporter 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
vacuolar part 1.508 14.07
cytoplasmic vesicle part 1.438 13.31
vesicle membrane 1.7 13.31
cell projection membrane 1.792 10.75
clathrin-coated vesicle 2.036 10.25
secretory vesicle 1.533 10.12
presynapse 1.761 9.44
integral component of plasma membrane 1.37 7.83
exocytic vesicle 2.005 6.94
brush border 1.358 6.66
Biological Process IC (bits) H-Score
carbohydrate transport 2.202 59.96
ion transport 1.478 33.86
nitrogen compound transport 1.741 33.7
transmembrane transport 1.614 30.18
secretion 1.518 28.86
renal system process 1.887 28.86
synaptic vesicle cycle 2.221 16.87
neurotransmitter transport 2.134 16.87
cellular chemical homeostasis 1.528 15.74
ion homeostasis 1.497 15.74

Protein sequence

External link(s) Locus: YAL067C   Protein: S000000062
Sequence length 593
Comment SEO1 SGDID:S000000062, Chr I from 9017-7236, reverse complement, Verified ORF, "Putative permease, member of the allantoate transporter subfamily of the major facilitator superfamily; mutation confers resistance to ethionine sulfoxide"
Sequence
MYSIVKEIIVDPYKRLKWGFIPVKRQVEDLPDDLNSTEIVTISNSIQSHETAENFITTTS
EKDQLHFETSSYSEHKDNVNVTRSYEYRDEADRPWWRFFDEQEYRINEKERSHNKWYSWF
KQGTSFKEKKLLIKLDVLLAFYSCIAYWVKYLDTVNINNAYVSGMKEDLGFQGNDLVHTQ
VMYTVGNIIFQLPFLIYLNKLPLNYVLPSLDLCWSLLTVGAAYVNSVPHLKAIRFFIGAF
EAPSYLAYQYLFGSFYKHDEMVRRSAFYYLGQYIGILSAGGIQSAVYSSLNGVNGLEGWR
WNFIIDAIVSVVVGLIGFYSLPGDPYNCYSIFLTDDEIRLARKRLKENQTGKSDFETKVF
DIKLWKTIFSDWKIYILTLWNIFCWNDSNVSSGAYLLWLKSLKRYSIPKLNQLSMITPGL
GMVYLMLTGIIADKLHSRWFAIIFTQVFNIIGNSILAAWDVAEGAKWFAFMLQCFGWAMA
PVLYSWQNDICRRDAQTRAITLVTMNIMAQSSTAWISVLVWKTEEAPRYLKGFTFTACSA
FCLSIWTFVVLYFYKRDERNNAKKNGIVLYNSKHGVEKPTSKDVETLSVSDEK
Download sequence
Identical sequences P39709
4932.YAL067C YAL067C YAL067C YAL067C YAL067C YAL067C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]