SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL068W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YAL068W-A   Protein: S000028594
Sequence length 84
Comment YAL068W-A SGDID:S000028594, Chr I from 538-792, Dubious ORF, "Dubious open reading frame unlikely to encode a protein; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MHGTCLSGLYPVPFTHNAHHYPHFDIYISFGGPKYCITALNTYVIPLLHHILTTPFIYTY
VNITEKSPQKSPKHKNILLFNNNT
Download sequence
Identical sequences Q8TGK7
YAL068W-A 4932.YAL068W-A YAL068W-A YAL068W-A YAL068W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]