SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL068W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YAL068W-A   Protein: S000028594
Sequence length 84
Comment YAL068W-A SGDID:S000028594, Chr I from 538-792, Dubious ORF, "Dubious open reading frame unlikely to encode a protein; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MHGTCLSGLYPVPFTHNAHHYPHFDIYISFGGPKYCITALNTYVIPLLHHILTTPFIYTY
VNITEKSPQKSPKHKNILLFNNNT
Download sequence
Identical sequences Q8TGK7
YAL068W-A YAL068W-A 4932.YAL068W-A YAL068W-A YAL068W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]