SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL069W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YAL069W   Protein: S000002143
Sequence length 104
Comment YAL069W SGDID:S000002143, Chr I from 335-649, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MIVNNTHVLTLPLYTTTTCHTHPHLYTDFTYAHGCYSIYHLKLTLLSDSTSLHGPSLTES
VPNALTSLCTALASAVYTLCHLPITPIIIHILISISHSAVPNIV
Download sequence
Identical sequences O13588
4932.YAL069W YAL069W YAL069W YAL069W YAL069W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]