SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAL069W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YAL069W   Protein: S000002143
Sequence length 104
Comment YAL069W SGDID:S000002143, Chr I from 335-649, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MIVNNTHVLTLPLYTTTTCHTHPHLYTDFTYAHGCYSIYHLKLTLLSDSTSLHGPSLTES
VPNALTSLCTALASAVYTLCHLPITPIIIHILISISHSAVPNIV
Download sequence
Identical sequences O13588
YAL069W YAL069W 4932.YAL069W YAL069W YAL069W

Jump to [ Top of page · Domain architecture · Domain assignment details ]