SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAR008W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAR008W
Domain Number 1 Region: 182-265
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 2.62e-22
Family tRNA-intron endonuclease catalytic domain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
ribonuclease activity 1.944 160.84
endonuclease activity 2.102 160.84
nuclease activity 1.722 14.73
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
RNA processing 1.457 55.63
ncRNA processing 1.878 11.67
RNA phosphodiester bond hydrolysis 2.034 6.67
nucleic acid phosphodiester bond hydrolysis 1.723 6.1
ncRNA metabolic process 1.572 3.36

Protein sequence

External link(s) Locus: YAR008W   Protein: S000000066
Sequence length 275
Comment SEN34 SGDID:S000000066, Chr I from 158967-159794, Verified ORF, "Subunit of the tRNA splicing endonuclease, which is composed of Sen2p, Sen15p, Sen34p, and Sen54p; Sen34p contains the active site for tRNA 3' splice site cleavage and has similarity to Sen2p and to Archaeal tRNA splicing endonuclease"
Sequence
MPPLVFDIDHIKLLRKWGICGVLSGTLPTAAQQNVFLSVPLRLMLEDVLWLHLNNLADVK
LIRQEGDEIMEGITLERGAKLSKIVNDRLNKSFEYQRKFKKDEHIAKLKKIGRINDKTTA
EELQRLDKSSNNDQLIESSLFIDIANTSMILRDIRSDSDSLSRDDISDLLFKQYRQAGKM
QTYFLYKALRDQGYVLSPGGRFGGKFIAYPGDPLRFHSHLTIQDAIDYHNEPIDLISMIS
GARLGTTVKKLWVIGGVAEETKETHFFSIEWAGFG
Download sequence
Identical sequences A7A0H1 G2W8N4 P39707
YAR008W 4932.YAR008W YAR008W YAR008W YAR008W YAR008W tr|A7A0H1|A7A0H1_YEAS7 355181 YAR008W YAR008W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]