SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAR009C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAR009C
Domain Number 1 Region: 103-253
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.82e-24
Family Retroviral integrase, catalytic domain 0.0086
Further Details:      
 
Domain Number 2 Region: 773-921,967-1103
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.11e-09
Family Reverse transcriptase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
replication fork 2.197 26.37
ribonucleoprotein granule 1.998 22.36
ribonucleoprotein complex 1.415 15.55
small nuclear ribonucleoprotein complex 2.004 13.11
exosome (RNase complex) 2.218 10.39
mitochondrial matrix 1.716 9.32
nucleoplasm part 1.419 5.59
nuclear body 1.911 5.59
chromosomal part 1.478 5.32
nuclear periphery 2.218 5.13

Protein sequence

External link(s) Locus: YAR009C   Protein: S000000067
Sequence length 1196
Comment YAR009C SGDID:S000000067, Chr I from 164188-160598, reverse complement, transposable_element_gene, "Retrotransposon TYA Gag and TYB Pol genes; in YARCTY1-1 TYB is mutant and probably non-functional"
Sequence
METFTGYLKSTCFHQISPYPPSIMSIQVKVHANILILSFIECLRMPMHRQIRYSLKNNTI
TYFNESDVDWSSAIDYQCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNL
PKSAPSYFISFTDETTKLRWVYPLHDRREDSILDVFTTILAFIKNQFQASVLVIQMDRGS
EYTNRTLHKFLEKNGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSA
IEFSTIVRNSLASPKSKKSARQHAGLAGLDISTLLPFGQPVIVNDHNPNSKIHPRGIPGY
ALHPSRNSYGYIIYLPSLKKTVDTTNYVILQGKESRLDQFNYDALTFDEDLNRLTASYHS
FIASNEIQESNDLNIESDHDFQSDIELHPEQPRNVLSKAVSPTDSTPPSTHTEDSKRVSK
TNIRAPREVDPNISESNILPSKKRSSTPQISNIESTGSGGMHKLNVPLLAPMSQSNTHES
SHASKSKDFRHSDSYSENETNHTNVPISSTGGTNNKTVPQISDQETEKRIIHRSPSIDAS
PPENNSSHNIVPIKTPTTVSEQNTEESIIADLPLPDLPPESPTEFPDPFKELPPINSHQT
NSSLGGIGDSNAYTTINSKKRSLEDNETEIKVSRDTWNTKNMRSLEPPRSKKRIHLIAAV
KAVKSIKPIRTTLRYDEAITYNKDIKEKEKYIEAYHKEVNQLLKMNTWDTDKYYDRKEID
PKRVINSMFIFNKKRDGTHKARFVARGDIQHPDTYDTGMQSNTVHHYALMTSLSLALDNN
YYITQLDISSAYLYADIKEELYIRPPPHLGMNDKLIRLKKSLYGLKQSGANWYETIKSYL
IKQCGMEEVRGWSCVFKNSQVTICLFVDDMILFSKDLNANKKIITTLKKQYDTKIINLGE
SDNEIQYDILGLEIKYQRGKYMKLGMEKSLTEKLPKLNVPLNPKGKKLRAPGQPGLYIDQ
DELEIDEDEYKEKVHEMQKLIGLASYVGYKFRFDLLYYINTLAQHILFPSRQVLDMTYEL
IQFMWDTRDKQLIWHKNKPTEPDNKLVAISDASYGNQPYYKSQIGNIYLLNGKVIGGKST
KASLTCTSTTEAEIHAISESVPLLNNLSYLIQELNKKPIIKGLLTDSRSTISIIKSTNEE
KFRNRFFGTKAMRLRDEVSGNNLYVYYIETKKNIADVMTKPLPIKTFKLLTNKWIH
Download sequence
Identical sequences O13527
YAR009C 4932.YAR009C YAR009C YR159 YAR009C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]