SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAR015W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAR015W
Domain Number 1 Region: 12-304
Classification Level Classification E-value
Superfamily SAICAR synthase-like 4.25e-107
Family SAICAR synthase 2.89e-11
Further Details:      
 

Protein sequence

External link(s) Locus: YAR015W   Protein: S000000070
Sequence length 306
Comment ADE1 SGDID:S000000070, Chr I from 169370-170290, Verified ORF, "N-succinyl-5-aminoimidazole-4-carboxamide ribotide (SAICAR) synthetase, required for 'de novo' purine nucleotide biosynthesis; red pigment accumulates in mutant cells deprived of adenine"
Sequence
MSITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKL
SEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVI
VRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEQGEHDENISPAQAA
ELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDS
SRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLT
GSKWSH
Download sequence
Identical sequences A7A0H3 B3LUT3 B5VDM5 C7GUF6 C8Z3I5 E7K967 E7KJY5 E7QB52 G2W8N6 H0GBZ3 N1P7M3 P27616 W7PYC1 W7R5Z6
YAR015W YAR015W YAR015W YAR015W YAR015W YAR015W YAR015W YAR015W YAR015W 4932.YAR015W YAR015W SCRT_05630 YAR015W YAR015W tr|A7A0H3|A7A0H3_YEAS7 YAR015W YAR015W YAR015W YAR015W YAR015W

Jump to [ Top of page · Domain architecture · Domain assignment details ]