SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAR015W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAR015W
Domain Number 1 Region: 12-304
Classification Level Classification E-value
Superfamily SAICAR synthase-like 4.25e-107
Family SAICAR synthase 0.0000000000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
lyase activity 1.474 37.57
ligase activity, forming carbon-nitrogen bonds 1.498 15.57
phospholipid binding 1.517 9.38
calmodulin binding 2.02 8.89
carboxy-lyase activity 2.068 7.2
Biological Process IC (bits) H-Score
phosphatidylinositol metabolic process 2.061 84.06
lipid modification 1.941 67.06
glycerolipid metabolic process 1.672 57.26
phospholipid metabolic process 1.622 50.28
germ cell development 1.469 48.88
developmental maturation 1.52 48.88
organelle localization 1.518 48.88
axis specification 1.739 48.88
female gamete generation 1.489 48.88
oocyte differentiation 2.128 48.88
Cellular Component IC (bits) H-Score
intermediate filament cytoskeleton 2.159 26.71
cell projection membrane 1.523 11.01
cell leading edge 1.449 11.01
ruffle 1.806 11.01
apical plasma membrane 1.449 6.38
leading edge membrane 2.208 6.18
endosome 1.323 5.08
endosome membrane 1.968 5.08
cytosol 1.301 4.73
late endosome 1.881 3.7

Protein sequence

External link(s) Locus: YAR015W   Protein: S000000070
Sequence length 306
Comment ADE1 SGDID:S000000070, Chr I from 169370-170290, Verified ORF, "N-succinyl-5-aminoimidazole-4-carboxamide ribotide (SAICAR) synthetase, required for 'de novo' purine nucleotide biosynthesis; red pigment accumulates in mutant cells deprived of adenine"
Sequence
MSITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKL
SEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVI
VRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEQGEHDENISPAQAA
ELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDS
SRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLT
GSKWSH
Download sequence
Identical sequences A7A0H3 B3LUT3 B5VDM5 C7GUF6 C8Z3I5 E7K967 E7KJY5 E7QB52 G2W8N6 H0GBZ3 N1P7M3 P27616 W7PYC1 W7R5Z6
YAR015W YAR015W YAR015W SCRT_05630 YAR015W YAR015W YAR015W YAR015W 4932.YAR015W YAR015W YAR015W YAR015W YAR015W YAR015W YAR015W YAR015W tr|A7A0H3|A7A0H3_YEAS7 YAR015W YAR015W YAR015W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]