SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAR061W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YAR061W   Protein: S000000087
Sequence length 67
Comment YAR061W SGDID:S000000087, Chr I from 218131-218334, pseudogene, "Hypothetical protein"
Sequence
MPYHYLFLALFTYLATSNVVSGSTQACLPVGPRKNGMNVNFYKYSLLDSTTYSYPQYMTS
GYASNWN
Download sequence
Identical sequences B3LUS1 C7GTT7 C8Z3N5 P0CX90 P0CX91
YAR061W YHR212W-A YHR212W-A YHR212W-A YHR212W-A YHR212W-A YHR212W-A YHR212W-A YHR212W-A YHR212W-A 4932.YHR212W-A YHR212W-A YHR212W-A SCRT_05611 YHR212W-A YHR212W-A YHR212W-A YHR212W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]