SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAR061W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YAR061W   Protein: S000000087
Sequence length 67
Comment YAR061W SGDID:S000000087, Chr I from 218131-218334, pseudogene, "Hypothetical protein"
Sequence
MPYHYLFLALFTYLATSNVVSGSTQACLPVGPRKNGMNVNFYKYSLLDSTTYSYPQYMTS
GYASNWN
Download sequence
Identical sequences B3LUS1 C7GTT7 C8Z3N5 P0CX90 P0CX91 W7RF21
YAR061W YHR212W-A YHR212W-A YHR212W-A YHR212W-A YHR212W-A YHR212W-A YHR212W-A YHR212W-A YHR212W-A 4932.YHR212W-A YHR212W-A YHR212W-A SCRT_05611 YHR212W-A YHR212W-A YHR212W-A YHR212W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]