SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAR062W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAR062W
Domain Number 1 Region: 2-39,66-170
Classification Level Classification E-value
Superfamily Anthrax protective antigen 0.00000575
Family Anthrax protective antigen 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
microtubule cytoskeleton 1.341 16.54
ciliary part 1.844 8.34
apical plasma membrane 1.449 7.71
cilium 1.573 5.89

Protein sequence

External link(s) Locus: YAR062W   Protein: S000000088
Sequence length 198
Comment YAR062W SGDID:S000000088, Chr I from 218540-219136, pseudogene, "Hypothetical protein"
Sequence
MTGYFLPPQTSSYTFRFAKVDDSAILSVGGNVAFECCAQEQPPITSTDFTINGIKPWQGS
LPDNIGGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDDFEGYVYSFDDDLS
QSNCTIPDPSKHTTSIVTTTTELWTGTFTSTSTEMTTVTGTNGQPTDETVIVAKAPTTAT
SSSLSSSSSEQITSSITS
Download sequence
Identical sequences E7KJM8 E7M241 H0GC07 N1P4Z0 P0CI66 P0CI67
YHR213W 4932.YHR213W YAR062W YHR213W YHR213W YHR213W YHR213W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]