SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YAR062W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YAR062W
Domain Number 1 Region: 2-39,66-170
Classification Level Classification E-value
Superfamily Anthrax protective antigen 5.75e-06
Family Anthrax protective antigen 0.026
Further Details:      
 

Protein sequence

External link(s) Locus: YAR062W   Protein: S000000088
Sequence length 198
Comment YAR062W SGDID:S000000088, Chr I from 218540-219136, pseudogene, "Hypothetical protein"
Sequence
MTGYFLPPQTSSYTFRFAKVDDSAILSVGGNVAFECCAQEQPPITSTDFTINGIKPWQGS
LPDNIGGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDDFEGYVYSFDDDLS
QSNCTIPDPSKHTTSIVTTTTELWTGTFTSTSTEMTTVTGTNGQPTDETVIVAKAPTTAT
SSSLSSSSSEQITSSITS
Download sequence
Identical sequences E7KJM8 E7M241 H0GC07 N1P4Z0 P0CI66 P0CI67
YHR213W YAR062W YHR213W 4932.YHR213W YHR213W YHR213W YHR213W

Jump to [ Top of page · Domain architecture · Domain assignment details ]