SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YBL002W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL002W
Domain Number 1 Region: 13-128
Classification Level Classification E-value
Superfamily Histone-fold 1.6e-50
Family Nucleosome core histones 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nuclear transcription factor complex 2.016 47.43
protein-DNA complex 1.923 40.48
chromosomal part 1.512 33.06
transferase complex 1.369 32.9
ATPase complex 2.002 23.63
replication fork 2.213 10.99
extracellular space 1.3 10.51
nucleoplasm part 1.369 8.5
methyltransferase complex 2.143 7.64
chromosomal region 1.996 7.41

Protein sequence

External link(s) Locus: YBL002W   Protein: S000000098
Sequence length 131
Comment HTB2 SGDID:S000000098, Chr II from 236495-236890, Verified ORF, "One of two nearly identical (see HTB1) histone H2B subtypes required for chromatin assembly and chromosome function; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates transcriptional activation, meiotic DSB formation and H3 methylation"
Sequence
MSSAAEKKPASKAPAEKKPAAKKTSTSVDGKKRSKVRKETYSSYIYKVLKQTHPDTGISQ
KSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSSTQA
Download sequence
Identical sequences A0A0L8VVI5 A6ZKU6 B3LNE1 C7GM50 C8Z3Z6 E7K9N9 E7KK50 E7LR39 E7Q0U2 E7QBB9 G2W907 H0GC78 N1P9S0 P02294
YBL002W YBL002W YBL002W YBL002W YBL002W YBL002W YBL002W YBL002W tr|A6ZKU6|A6ZKU6_YEAS7 YBL002W YBL002W YBL002W SCRT_02965 YBL002W YBL002W YBL002W YBL002W YBL002W YBL002W YBL002W 4932.YBL002W YBL002W YBL002W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]