SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YBL002W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL002W
Domain Number 1 Region: 13-128
Classification Level Classification E-value
Superfamily Histone-fold 1.6e-50
Family Nucleosome core histones 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.419 38.26
chromosomal part 1.478 32.11
transcription factor complex 1.881 31.3
DNA-directed RNA polymerase complex 2.004 27.86
SWI/SNF superfamily-type complex 2.177 23.8
lipid particle 1.519 21.32
nuclear chromosome 1.723 11.75
replication fork 2.197 11.75
condensed chromosome 2.187 9.51
methyltransferase complex 2.218 8.09

Protein sequence

External link(s) Locus: YBL002W   Protein: S000000098
Sequence length 131
Comment HTB2 SGDID:S000000098, Chr II from 236495-236890, Verified ORF, "One of two nearly identical (see HTB1) histone H2B subtypes required for chromatin assembly and chromosome function; Rad6p-Bre1p-Lge1p mediated ubiquitination regulates transcriptional activation, meiotic DSB formation and H3 methylation"
Sequence
MSSAAEKKPASKAPAEKKPAAKKTSTSVDGKKRSKVRKETYSSYIYKVLKQTHPDTGISQ
KSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSSTQA
Download sequence
Identical sequences A6ZKU6 B3LNE1 C7GM50 C8Z3Z6 E7K9N9 E7KK50 E7LR39 E7Q0U2 E7QBB9 G2W907 H0GC78 N1P9S0 P02294 W7PQ44 W7R182
YBL002W 4932.YBL002W tr|A6ZKU6|A6ZKU6_YEAS7 YBL002W YBL002W YBL002W SCRT_02965 YBL002W YBL002W YBL002W YBL002W YBL002W YBL002W YBL002W YBL002W YBL002W YBL002W YBL002W YBL002W YBL002W YBL002W YBL002W YBL002W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]