SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YBL013W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL013W
Domain Number 1 Region: 30-203
Classification Level Classification E-value
Superfamily Formyltransferase 1.83e-27
Family Formyltransferase 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YBL013W   Protein: S000000109
Sequence length 401
Comment FMT1 SGDID:S000000109, Chr II from 202059-203264, Verified ORF, "Methionyl-tRNA formyltransferase, catalyzes the formylation of initiator Met-tRNA in mitochondria; potential Cdc28p substrate"
Sequence
MVKMRRITPTRLLFTCRYISNNASPPVQPLNVLFFGSDTFSNFSLQALNELRQNNGSCGI
VDNIQVVTRSPKWCGRQKSILKYPPIFDMAEKLQLPRPITCDTKQEMLALSKLTPSRQGN
PENDGSGAPFNAIIAVSFGKLIPGDLIRAVPLALNVHPSLLPRHKGSAPIQRALLEGDTY
TGVTIQTLHPDRFDHGAIVAQTEPLAIATMLSKGRVNDSTADFNSEGLPRRTAILMDQLG
ALGAQLLGQTLRERLYLPQNRVQAPTAYKPSYAHRITTEDKRIHWARDSAAELLNKLETL
GPLHAFKEATAARKDAQNSVLKRILFHECKVMRDARLDNGSKPGMFKYDDIKDCILVTCR
GNLLLCVSRLQFEGFAVERAGQFMARLRKRCGALSEKLVFL
Download sequence
Identical sequences N1P909 P32785
4932.YBL013W YBL013W YBL013W YBL013W YBL013W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]