SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL013W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL013W
Domain Number 1 Region: 30-203
Classification Level Classification E-value
Superfamily Formyltransferase 1.83e-27
Family Formyltransferase 0.00073
Further Details:      
 

Protein sequence

External link(s) Locus: YBL013W   Protein: S000000109
Sequence length 401
Comment FMT1 SGDID:S000000109, Chr II from 202059-203264, Verified ORF, "Methionyl-tRNA formyltransferase, catalyzes the formylation of initiator Met-tRNA in mitochondria; potential Cdc28p substrate"
Sequence
MVKMRRITPTRLLFTCRYISNNASPPVQPLNVLFFGSDTFSNFSLQALNELRQNNGSCGI
VDNIQVVTRSPKWCGRQKSILKYPPIFDMAEKLQLPRPITCDTKQEMLALSKLTPSRQGN
PENDGSGAPFNAIIAVSFGKLIPGDLIRAVPLALNVHPSLLPRHKGSAPIQRALLEGDTY
TGVTIQTLHPDRFDHGAIVAQTEPLAIATMLSKGRVNDSTADFNSEGLPRRTAILMDQLG
ALGAQLLGQTLRERLYLPQNRVQAPTAYKPSYAHRITTEDKRIHWARDSAAELLNKLETL
GPLHAFKEATAARKDAQNSVLKRILFHECKVMRDARLDNGSKPGMFKYDDIKDCILVTCR
GNLLLCVSRLQFEGFAVERAGQFMARLRKRCGALSEKLVFL
Download sequence
Identical sequences N1P909 P32785
YBL013W YBL013W 4932.YBL013W YBL013W YBL013W

Jump to [ Top of page · Domain architecture · Domain assignment details ]