SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YBL030C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL030C
Domain Number 1 Region: 19-308
Classification Level Classification E-value
Superfamily Mitochondrial carrier 8.5e-77
Family Mitochondrial carrier 0.000000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
mitochondrial envelope 1.596 75.11
organelle inner membrane 1.689 73.99
microtubule cytoskeleton 1.399 25.19
plastid 1.489 10.36
integral component of organelle membrane 2.008 8.69
microbody 1.813 7.6
intracellular ribonucleoprotein complex 1.329 7.58
cytoplasmic ribonucleoprotein granule 1.891 7.58
outer membrane 2.082 6.12

Protein sequence

External link(s) Locus: YBL030C   Protein: S000000126
Sequence length 318
Comment PET9 SGDID:S000000126, Chr II from 164000-163044, reverse complement, Verified ORF, "Major ADP/ATP carrier of the mitochondrial inner membrane, exchanges cytosolic ADP for mitochondrially synthesized ATP; phosphorylated; required for viability in many common lab strains carrying a mutation in the polymorphic SAL1 gene"
Sequence
MSSNAQVKTPLPPAPAPKKESNFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQ
GTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKE
EGYAKWFAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKT
LKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVTTG
ASTCSYPLDTVRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAG
VISMYDQLQMILFGKKFK
Download sequence
Identical sequences A6ZKR7 G2W8X8 N1PAX7 P18239
YBL030C YBL030C YBL030C YBL030C YBL030C YBL030C 1067M YBL030C 4c9g.A 4c9h.A 4c9h.B tr|A6ZKR7|A6ZKR7_YEAS7 4932.YBL030C YBL030C YBL030C YBL030C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]