SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL030C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL030C
Domain Number 1 Region: 19-308
Classification Level Classification E-value
Superfamily Mitochondrial carrier 8.5e-77
Family Mitochondrial carrier 7.9e-08
Further Details:      
 

Protein sequence

External link(s) Locus: YBL030C   Protein: S000000126
Sequence length 318
Comment PET9 SGDID:S000000126, Chr II from 164000-163044, reverse complement, Verified ORF, "Major ADP/ATP carrier of the mitochondrial inner membrane, exchanges cytosolic ADP for mitochondrially synthesized ATP; phosphorylated; required for viability in many common lab strains carrying a mutation in the polymorphic SAL1 gene"
Sequence
MSSNAQVKTPLPPAPAPKKESNFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQ
GTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKE
EGYAKWFAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKT
LKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVTTG
ASTCSYPLDTVRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAG
VISMYDQLQMILFGKKFK
Download sequence
Identical sequences A6ZKR7 G2W8X8 N1PAX7 P18239
YBL030C 4932.YBL030C YBL030C YBL030C YBL030C YBL030C tr|A6ZKR7|A6ZKR7_YEAS7 YBL030C YBL030C 1067M YBL030C YBL030C YBL030C

Jump to [ Top of page · Domain architecture · Domain assignment details ]