SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL030C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL030C
Domain Number 1 Region: 19-308
Classification Level Classification E-value
Superfamily Mitochondrial carrier 8.5e-77
Family Mitochondrial carrier 7.9e-08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
organelle inner membrane 1.673 62.04
mitochondrial envelope 1.571 58.85
microtubule cytoskeleton 1.334 20.08
plastid 1.598 10.19
chloroplast part 1.897 10.19
mitochondrial inner membrane 1.752 5.48
microbody 1.956 4.87
intrinsic to organelle membrane 2.091 4.87
outer membrane 2.24 4.86
mitochondrial membrane part 1.917 4.04

Protein sequence

External link(s) Locus: YBL030C   Protein: S000000126
Sequence length 318
Comment PET9 SGDID:S000000126, Chr II from 164000-163044, reverse complement, Verified ORF, "Major ADP/ATP carrier of the mitochondrial inner membrane, exchanges cytosolic ADP for mitochondrially synthesized ATP; phosphorylated; required for viability in many common lab strains carrying a mutation in the polymorphic SAL1 gene"
Sequence
MSSNAQVKTPLPPAPAPKKESNFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQ
GTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKE
EGYAKWFAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKT
LKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVTTG
ASTCSYPLDTVRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAG
VISMYDQLQMILFGKKFK
Download sequence
Identical sequences A6ZKR7 G2W8X8 N1PAX7 P18239
YBL030C 4932.YBL030C YBL030C YBL030C YBL030C YBL030C tr|A6ZKR7|A6ZKR7_YEAS7 YBL030C 4c9g.A 4c9h.A 4c9h.B YBL030C 1067M YBL030C YBL030C YBL030C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]