SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YBL041W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL041W
Domain Number 1 Region: 22-238
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.46e-58
Family Proteasome subunits 0.00000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
external side of plasma membrane 1.922 22.25
cytosol 1.305 13.2
ribonucleoprotein complex 1.415 6.89
extracellular organelle 1.592 4.91
ribonucleoprotein granule 1.998 4.32

Protein sequence

External link(s) Locus: YBL041W   Protein: S000000137
Sequence length 241
Comment PRE7 SGDID:S000000137, Chr II from 141250-141975, Verified ORF, "Beta 6 subunit of the 20S proteasome"
Sequence
MATIASEYSSEASNTPIEHQFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEP
KVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR
FFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYE
PGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKR
D
Download sequence
Identical sequences A6ZKQ5 B5VDU3 C7GNC1 C8Z3Q6 E7KK27 E7LRC2 E7Q0S1 E7QB93 G2W8W6 H0GC51 N1P9Q3 P23724 W7RHL3
YBL041W YBL041w___KOG0179 1g0u.L 1g0u.Z 2zcy.L 2zcy.Z 3bdm.L 3bdm.Z 3mg6.L 3mg6.Z 3mg7.L 3mg7.Z 3mg8.L 3mg8.Z 3nzj.L 3nzj.Z 3nzw.L 3nzw.Z 3nzx.L 3nzx.Z 4b4t.6 4bgr.6 4c0v.6 4cr2.6 4cr3.6 4cr4.6 1g0uL YBL041W YBL041W YBL041W YBL041W tr|A6ZKQ5|A6ZKQ5_YEAS7 YBL041W YBL041W 4932.YBL041W YBL041W YBL041W YBL041W YBL041W YBL041W YBL041W YBL041W YBL041W YBL041W YBL041W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]