SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL041W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL041W
Domain Number 1 Region: 22-238
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.46e-58
Family Proteasome subunits 1.21e-09
Further Details:      
 

Protein sequence

External link(s) Locus: YBL041W   Protein: S000000137
Sequence length 241
Comment PRE7 SGDID:S000000137, Chr II from 141250-141975, Verified ORF, "Beta 6 subunit of the 20S proteasome"
Sequence
MATIASEYSSEASNTPIEHQFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEP
KVFDCGDNIVMSANGFAADGDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR
FFPYYVHTIIAGLDEDGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYE
PGTNGKVKKPLKYLSVEEVIKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKR
D
Download sequence
Identical sequences A6ZKQ5 B5VDU3 C7GNC1 C8Z3Q6 E7KK27 E7LRC2 E7Q0S1 E7QB93 G2W8W6 H0GC51 P23724
YBL041W 1g0uL YBL041W YBL041W YBL041W YBL041W YBL041W 4932.YBL041W YBL041W YBL041W YBL041W tr|A6ZKQ5|A6ZKQ5_YEAS7 YBL041W 1g0u.L 1g0u.Z 2zcy.L 2zcy.Z 3bdm.L 3bdm.Z 3mg6.L 3mg6.Z 3mg7.L 3mg7.Z 3mg8.L 3mg8.Z 3nzj.L 3nzj.Z 3nzw.L 3nzw.Z 3nzx.L 3nzx.Z 4b4t.6 YBL041W YBL041W YBL041W YBL041w___KOG0179 YBL041W YBL041W YBL041W YBL041W

Jump to [ Top of page · Domain architecture · Domain assignment details ]