SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL042C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBL042C   Protein: S000000138
Sequence length 639
Comment FUI1 SGDID:S000000138, Chr II from 140263-138344, reverse complement, Verified ORF, "High affinity uridine permease, localized to the plasma membrane; not involved in uracil transport"
Sequence
MPVSDSGFDNSSKTMKDDTIPTEDYEEITKESEMGDATKITSKIDANVIEKKDTDSENNI
TIAQDDEKVSWLQRVVEFFEVKNDSTDLADHKPENPIRTFKDLQESLRSTYLYNTDLRPV
EAKRRTWTWKQYIFFWISGSFNVNTWQISATGLQLGLNWWQTWICIWVGYTFVAFFLILG
SKVGNNYHISFPISSRVSFGIYFSIWIVINRVVMACVWNSTLAYIGSQCVQLMLKAIFGT
NLNTRIKDTIKNPNLTNFEFMCFMVFWVACLPFLWFPPDKLRHIFALKSAITPFAAFGFL
IWTLCKAKGHLALGSLNDNGGAISKTVLAWSVIRAIMSALDNFSTLILNAPDFTRFGKTY
KSSVYSQLIALPVCYAIISLIGILSVSAAYTLYGVNYWSPLDILNRYLDNYTSGNRAGVF
LISFIFAFDQLGANLSGNSIPAGTDLTALLPKFINIRRGSYICALISLAICPWDLLSSSS
KFTTALAAYAVFLSAIAGVISADYFIVRKGYVNIFHCYTDKPGSYYMYNKYGTNWRAVVA
YIFGIAPNFAGFLGSVGVSVPIGAMKVYYLNYFVGYLLAALSYCILVYFYPIKGIPGDAK
ITDRKWLEEWVEVEEFGTEREAFEEYGGVSTGYEKIRYI
Download sequence
Identical sequences P38196
YBL042C YBL042C 4932.YBL042C YBL042C YBL042C YBL042C

Jump to [ Top of page · Domain architecture · Domain assignment details ]