SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL042C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YBL042C   Protein: S000000138
Sequence length 639
Comment FUI1 SGDID:S000000138, Chr II from 140263-138344, reverse complement, Verified ORF, "High affinity uridine permease, localized to the plasma membrane; not involved in uracil transport"
Sequence
MPVSDSGFDNSSKTMKDDTIPTEDYEEITKESEMGDATKITSKIDANVIEKKDTDSENNI
TIAQDDEKVSWLQRVVEFFEVKNDSTDLADHKPENPIRTFKDLQESLRSTYLYNTDLRPV
EAKRRTWTWKQYIFFWISGSFNVNTWQISATGLQLGLNWWQTWICIWVGYTFVAFFLILG
SKVGNNYHISFPISSRVSFGIYFSIWIVINRVVMACVWNSTLAYIGSQCVQLMLKAIFGT
NLNTRIKDTIKNPNLTNFEFMCFMVFWVACLPFLWFPPDKLRHIFALKSAITPFAAFGFL
IWTLCKAKGHLALGSLNDNGGAISKTVLAWSVIRAIMSALDNFSTLILNAPDFTRFGKTY
KSSVYSQLIALPVCYAIISLIGILSVSAAYTLYGVNYWSPLDILNRYLDNYTSGNRAGVF
LISFIFAFDQLGANLSGNSIPAGTDLTALLPKFINIRRGSYICALISLAICPWDLLSSSS
KFTTALAAYAVFLSAIAGVISADYFIVRKGYVNIFHCYTDKPGSYYMYNKYGTNWRAVVA
YIFGIAPNFAGFLGSVGVSVPIGAMKVYYLNYFVGYLLAALSYCILVYFYPIKGIPGDAK
ITDRKWLEEWVEVEEFGTEREAFEEYGGVSTGYEKIRYI
Download sequence
Identical sequences P38196
YBL042C YBL042C YBL042C YBL042C YBL042C 4932.YBL042C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]