SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL048W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YBL048W   Protein: S000000144
Sequence length 103
Comment YBL048W SGDID:S000000144, Chr II from 127302-127613, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on experimental and comparative sequence data"
Sequence
MILFKNLVFLPSILIGYISIRVSLLVWVNWVLVWSSCFQVAFIFSLWYFILSIYTFFYSK
KIKQIISYEPSYFVFSYRAIDLCPERVLLYFFCIFNNVVFPML
Download sequence
Identical sequences P38192
YBL048W YBL048W YBL048W YBL048W YBL048W YBL048W 4932.YBL048W YBL048W YBL048W YBL048W YBL048W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]