SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL048W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBL048W   Protein: S000000144
Sequence length 103
Comment YBL048W SGDID:S000000144, Chr II from 127302-127613, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on experimental and comparative sequence data"
Sequence
MILFKNLVFLPSILIGYISIRVSLLVWVNWVLVWSSCFQVAFIFSLWYFILSIYTFFYSK
KIKQIISYEPSYFVFSYRAIDLCPERVLLYFFCIFNNVVFPML
Download sequence
Identical sequences P38192
YBL048W 4932.YBL048W YBL048W YBL048W YBL048W YBL048W YBL048W YBL048W YBL048W YBL048W YBL048W

Jump to [ Top of page · Domain architecture · Domain assignment details ]