SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YBL061C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL061C
Domain Number 1 Region: 293-538
Classification Level Classification E-value
Superfamily HCP-like 8.9e-39
Family HCP-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.419 40.71
DNA-directed RNA polymerase complex 2.004 8.35
chromosomal part 1.478 7.96
cell division site 2.218 6.81
chromatin 1.906 4.59
Molecular Function IC (bits) H-Score
protein serine/threonine kinase activity 1.73 33.74
protein domain specific binding 1.465 9.99

Protein sequence

External link(s) Locus: YBL061C   Protein: S000000157
Sequence length 696
Comment SKT5 SGDID:S000000157, Chr II from 107408-105318, reverse complement, Verified ORF, "Activator of Chs3p (chitin synthase III), recruits Chs3p to the bud neck via interaction with Bni4p; has similarity to Shc1p, which activates Chs3p during sporulation"
Sequence
MASSPQVHPYKKHLMQSQHINFDNRGLQFQNSSLKVGQDFSDNKENRENRDNEDFSTADL
PKRSANQPLINEHLRAASVPLLSNDIGNSQEEDFVPVPPPQLHLNNSNNTSLSSLGSTPT
NSPSPGALRQTNSSTSLTKEQIKKRTRSVDLSHMYLLNGSSDTQLTATNESVADLSHQMI
SRYLGGKNNTSLVPRLKTIEMYRQNVKKSKDPEVLFQYAQYMLQTALTIESSNALVQDSD
KEGNVSQSDLKLQFLKEAQSYLKKLSIKGYSDAQYLLADGYSSGAFGKIENKEAFVLFQA
AAKHGHIESAYRASHCLEEGLGTTRDSRKSVNFLKFAASRNHPSAMYKLGLYSFYGRMGL
PTDVNTKLNGVKWLSRAAARANELTAAAPYELAKIYHEGFLDVVIPDEKYAMELYIQAAS
LGHVPSATLLAQIYETGNDTVGQDTSLSVHYYTQAALKGDSVAMLGLCAWYLLGAEPAFE
KDENEAFQWALRAANAGLPKAQFTLGYFYEHGKGCDRNMEYAWKWYEKAAGNEDKRAINK
LRSRDGGLASIGKKQHKKNKSISTLNLFSTVDSQTSNVGSNSRVSSKSETFFTGNPKRDR
EPQGLQINMNSNTNRNGIKTGSDTSIRKSSSSAKGMSREVAEQSMAAKQEVSLSNMGSSN
MIRKDFPAVKTESKKPTSLKNKKDKQGKKKKDCVIM
Download sequence
Identical sequences A6ZKN7 P34226
YBL061C YBL061C YBL061C YBL061C tr|A6ZKN7|A6ZKN7_YEAS7 4932.YBL061C YBL061C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]