SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL061C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL061C
Domain Number 1 Region: 293-538
Classification Level Classification E-value
Superfamily HCP-like 8.9e-39
Family HCP-like 0.001
Further Details:      
 

Protein sequence

External link(s) Locus: YBL061C   Protein: S000000157
Sequence length 696
Comment SKT5 SGDID:S000000157, Chr II from 107408-105318, reverse complement, Verified ORF, "Activator of Chs3p (chitin synthase III), recruits Chs3p to the bud neck via interaction with Bni4p; has similarity to Shc1p, which activates Chs3p during sporulation"
Sequence
MASSPQVHPYKKHLMQSQHINFDNRGLQFQNSSLKVGQDFSDNKENRENRDNEDFSTADL
PKRSANQPLINEHLRAASVPLLSNDIGNSQEEDFVPVPPPQLHLNNSNNTSLSSLGSTPT
NSPSPGALRQTNSSTSLTKEQIKKRTRSVDLSHMYLLNGSSDTQLTATNESVADLSHQMI
SRYLGGKNNTSLVPRLKTIEMYRQNVKKSKDPEVLFQYAQYMLQTALTIESSNALVQDSD
KEGNVSQSDLKLQFLKEAQSYLKKLSIKGYSDAQYLLADGYSSGAFGKIENKEAFVLFQA
AAKHGHIESAYRASHCLEEGLGTTRDSRKSVNFLKFAASRNHPSAMYKLGLYSFYGRMGL
PTDVNTKLNGVKWLSRAAARANELTAAAPYELAKIYHEGFLDVVIPDEKYAMELYIQAAS
LGHVPSATLLAQIYETGNDTVGQDTSLSVHYYTQAALKGDSVAMLGLCAWYLLGAEPAFE
KDENEAFQWALRAANAGLPKAQFTLGYFYEHGKGCDRNMEYAWKWYEKAAGNEDKRAINK
LRSRDGGLASIGKKQHKKNKSISTLNLFSTVDSQTSNVGSNSRVSSKSETFFTGNPKRDR
EPQGLQINMNSNTNRNGIKTGSDTSIRKSSSSAKGMSREVAEQSMAAKQEVSLSNMGSSN
MIRKDFPAVKTESKKPTSLKNKKDKQGKKKKDCVIM
Download sequence
Identical sequences A6ZKN7 P34226
YBL061C 4932.YBL061C YBL061C YBL061C YBL061C tr|A6ZKN7|A6ZKN7_YEAS7 YBL061C

Jump to [ Top of page · Domain architecture · Domain assignment details ]