SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL064C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL064C
Domain Number 1 Region: 49-259
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.79e-67
Family Glutathione peroxidase-like 3.32e-06
Further Details:      
 

Protein sequence

External link(s) Locus: YBL064C   Protein: S000000160
Sequence length 261
Comment PRX1 SGDID:S000000160, Chr II from 101158-100373, reverse complement, Verified ORF, "Mitochondrial peroxiredoxin (1-Cys Prx) with thioredoxin peroxidase activity, has a role in reduction of hydroperoxides; induced during respiratory growth and under conditions of oxidative stress; phosphorylated"
Sequence
MFSRICSAQLKRTAWTLPKQAHLQSQTIKTFATAPILCKQFKQSDQPRLRINSDAPNFDA
DTTVGKINFYDYLGDSWGVLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDV
ESHEKWIQDIKEIAKVKNVGFPIIGDTFRNVAFLYDMVDAEGFKNINDGSLKTVRSVFVI
DPKKKIRLIFTYPSTVGRNTSEVLRVIDALQLTDKEGVVTPINWQPADDVIIPPSVSNDE
AKAKFGQFNEIKPYLRFTKSK
Download sequence
Identical sequences A6ZKN5 B3LNJ9 B5VDS3 C7GNA2 E7LRA8 E7NEM4 G2W8U5 H0GC37 P34227
YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C 4932.YBL064C YBL064C SCRT_03027 YBL064C YBL064C tr|A6ZKN5|A6ZKN5_YEAS7 YBL064C YBL064C YBL064C YBL064C YBL064C

Jump to [ Top of page · Domain architecture · Domain assignment details ]