SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL064C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL064C
Domain Number 1 Region: 49-259
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.79e-67
Family Glutathione peroxidase-like 3.32e-06
Further Details:      
 

Protein sequence

External link(s) Locus: YBL064C   Protein: S000000160
Sequence length 261
Comment PRX1 SGDID:S000000160, Chr II from 101158-100373, reverse complement, Verified ORF, "Mitochondrial peroxiredoxin (1-Cys Prx) with thioredoxin peroxidase activity, has a role in reduction of hydroperoxides; induced during respiratory growth and under conditions of oxidative stress; phosphorylated"
Sequence
MFSRICSAQLKRTAWTLPKQAHLQSQTIKTFATAPILCKQFKQSDQPRLRINSDAPNFDA
DTTVGKINFYDYLGDSWGVLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDV
ESHEKWIQDIKEIAKVKNVGFPIIGDTFRNVAFLYDMVDAEGFKNINDGSLKTVRSVFVI
DPKKKIRLIFTYPSTVGRNTSEVLRVIDALQLTDKEGVVTPINWQPADDVIIPPSVSNDE
AKAKFGQFNEIKPYLRFTKSK
Download sequence
Identical sequences A6ZKN5 B3LNJ9 B5VDS3 C7GNA2 E7LRA8 E7NEM4 G2W8U5 H0GC37 N1PAW7 P34227 W7PKQ7 W7RE04
YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C 4932.YBL064C YBL064C SCRT_03027 YBL064C YBL064C tr|A6ZKN5|A6ZKN5_YEAS7 YBL064C YBL064C YBL064C YBL064C YBL064C

Jump to [ Top of page · Domain architecture · Domain assignment details ]