SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL071C-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBL071C-B   Protein: S000028597
Sequence length 32
Comment YBL071C-B SGDID:S000028597, Chr II from 89554-89456, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MELFHIRYLQAYLKVIGNYTCHLLFGTHKKTL
Download sequence
Identical sequences Q8TGU8
YBL071C-B 4932.YBL071C-B YBL071C-B YBL071C-B YBL071C-B YBL071C-B YBL071C-B YBL071C-B YBL071C-B

Jump to [ Top of page · Domain architecture · Domain assignment details ]