SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL071C-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YBL071C-B   Protein: S000028597
Sequence length 32
Comment YBL071C-B SGDID:S000028597, Chr II from 89554-89456, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MELFHIRYLQAYLKVIGNYTCHLLFGTHKKTL
Download sequence
Identical sequences Q8TGU8
YBL071C-B YBL071C-B YBL071C-B YBL071C-B YBL071C-B YBL071C-B 4932.YBL071C-B YBL071C-B YBL071C-B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]