SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL079W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YBL079W
Domain Number - Region: 186-313,351-386
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0439
Family WD40-repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YBL079W   Protein: S000000175
Sequence length 1502
Comment NUP170 SGDID:S000000175, Chr II from 75256-79764, Verified ORF, "Abundant subunit of the nuclear pore complex (NPC), required for proper localization of specific nucleoporins within the NPC, involved in nuclear envelope permeability and in chromosome segregation, has similarity to Nup157p"
Sequence
MFQSFFHNNGPAAAGETFSDSRSYPLTNHQEVPRNGLNELASSATKAQQQPTHILNSYPI
TGSNPLMRASAMGATSGSINPNMSNMNEHIRVSGMGTSKPLDLAGKYIDHLQHKDSNTPV
LDERSYYNSGVDYNFSREKNGLGAFTPFEKQDVFNIPDEILHEFSTSQTKTDMGIFPELN
RCWITIDNKLILWNINNDNEYQVVDDMKHTIQKVALVRPKPNTFVPAVKHLLLISTTMEL
FMFAISLDKATNELSVFNTHLSVPVQGIDVIDIVSHERSGRIFFAGQASGLNIWELHYSG
SDDWFNSKCSKVCLTKSALLSLLPTNMLSQIPGVDFIQALFEDNSNGNGGFSQETITQLT
IDQQRGIIYSLSSKSTIRAYVITEKSLEGPMSIEPAYISRIIGTTTARAAPILGPKYLKI
VKISSVAPEENNNLFLVALTVGGVRLYFNGSMGRFNIEALRLESIKFPPSSVTPEVIQQE
LLHQQQEQAKRSFPFFSNLMSSEPVLLKFQKKSSVLLETTKASTIISPGIFFSAVIKSSQ
QTHQQEKKENSSVTGTTATAGSKTVKQQPVTLQHKLFVSVPDYGILKTHGKYVENATFLE
TAGPVQQIIPLSGLFNATTKPQGFANEFATQYTSETLRVAVLTSTSIEIYKYRTPDEIFE
DLIDNPLPFVLNYGAAEACSTALFVTCKSNKSEKLRSNALTFLTMGIPGVVDIKPVYNRY
SVSTVSSLLSKPTLSTATTNLQQSITGFSKPSPANKEDFDLDDVILSPRFYGIALLITRL
LRDIWGRHVFMTFTDNRVTSHAFISSSDPITPSINNLKSDEISQNRNIISKVSISKDCIE
YYLSSINILNEFFITYGDSISQISAPYVLANNSNGRVIDKTEEVANQAESIAINAMIKMV
QSIKEGLSFLNVLYEESEVEGFDNQYLGFKDIISFVSLDVQKDLVKLDFKDLFAPNDKTK
SLIREILLSIINRNITKGASIEYTATALQERCGSFCSASDILGFRAIEHLRRAKEIGLRN
YDSLNYHLKNATALLEQIVDDLSIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLA
CQYVANGFLENDDRKQYYDKRILVYDLVFDTLIKVDELAEKKQSSKTQNQISISNDDEVK
LRQKSYEAALKYNDRLFHYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGSSLKISNIL
WVYYSRRSKFFESAEILYRLATSNFDITLFERIEFLSRANGFCNSVSPLSQKQRIVQLAS
RIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEI
ALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQD
SEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSD
NSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFY
KE
Download sequence
Identical sequences N1P8B8 P38181
YBL079W YBL079W YBL079W 4932.YBL079W NYSGXRC-15157a YBL079W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]