SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YBL090W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YBL090W   Protein: S000000186
Sequence length 177
Comment MRP21 SGDID:S000000186, Chr II from 48822-49355, Verified ORF, "Mitochondrial ribosomal protein of the large subunit; MRP21 exhibits genetic interactions with mutations in the COX2 and COX3 mRNA 5'-untranslated leader sequences"
Sequence
MLKSTLRLSRISLRRGFTTIDCLRQQNSDIDKIILNPIKLAQGSNSDRGQTSKSKTDNAD
ILSMEIPVDMMQSAGRINKRELLSEAEIARSSVENAQMRFNSGKSIIVNKNNPAESFKRL
NRIMFENNIPGDKRSQRFYMKPGKVAELKRSQRHRKEFMMGFKRLIEIVKDAKRKGY
Download sequence
Identical sequences B3LNM1 B5VDQ1 C7GSF4 C8Z3V5 E7K989 E7KK03 E7LR95 E7Q0P9 E7QB68 H0GC22 P38175
YBL090W YBL090W YBL090W YBL090W YBL090W YBL090W YBL090W YBL090W YT327 YBL090W YBL090W YBL090W 4932.YBL090W YBL090W SCRT_03049 YBL090W YBL090W YBL090W YBL090W YBL090W YBL090W

Jump to [ Top of page · Domain architecture · Domain assignment details ]